StarFunc result for job id O14920

User Input

>input (756 residues)
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88351	0.947	0.946	0.000	757	0.918	0.917	O88351.pdb.gz	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
2	AFDB:Q6INT1	0.862	0.878	2.342E-93	742	0.717	0.730	Q6INT1.pdb.gz	Q6INT1_XENLA IkappaB kinase OS=Xenopus laevis OX=8355 GN=ikbkb.L PE=1 SV=1
3	AFDB:B0R199	0.861	0.836	2.897E-80	779	0.603	0.585	B0R199.pdb.gz
4	AFDB:Q5ZI83	0.758	0.775	6.699E-76	739	0.673	0.689	Q5ZI83.pdb.gz	Q5ZI83_CHICK Protein kinase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_29g15 PE=2 SV=1
5	AFDB:Q5ZJB4	0.797	0.794	1.921E-73	759	0.493	0.491	Q5ZJB4.pdb.gz	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
6	AFDB:Q4G3H4	0.797	0.795	7.453E-72	758	0.505	0.504	Q4G3H4.pdb.gz	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
7	AFDB:O15111	0.772	0.782	1.775E-70	745	0.504	0.511	O15111.pdb.gz	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
8	AFDB:Q9VEZ5	0.692	0.697	6.463E-38	751	0.220	0.221	Q9VEZ5.pdb.gz	IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster OX=7227 GN=IKKbeta PE=1 SV=2
9	AFDB:Q9R0T8	0.516	0.541	6.781E-33	717	0.204	0.215	Q9R0T8.pdb.gz	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
10	AFDB:Q14164	0.517	0.541	8.242E-33	716	0.202	0.214	Q14164.pdb.gz	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
11	PDB:6o8bB	0.483	0.550	2.478E-29	657	0.183	0.210	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
12	PDB:4im0A	0.478	0.571	2.679E-27	619	0.179	0.218	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
13	PDB:6o8cA	0.468	0.543	1.760E-24	636	0.177	0.211	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
14	PDB:5u6yA	0.291	0.465	2.265E-15	459	0.093	0.153	5u6yA.pdb.gz
15	PDB:6pjxA	0.309	0.422	3.186E-15	543	0.104	0.145	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
16	PDB:6byrA	0.294	0.530	1.027E-14	405	0.103	0.193	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
17	PDB:3nynA	0.301	0.404	1.249E-14	554	0.099	0.135	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:1unlA	0.302	0.734	1.445E-14	292	0.102	0.264	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4rerA	0.297	0.481	1.518E-14	459	0.101	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:6b1uA	0.304	0.507	1.594E-14	442	0.101	0.172	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FJS7	0.0	1426	692	0.915	1.000	A0A499FJS7_HUMAN IkappaB kinase OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
2	A0A8I5ZSH4	0.0	659	685	0.430	0.474	A0A8I5ZSH4_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1
3	A0A8I6ANR6	0.0	735	713	0.480	0.509	A0A8I6ANR6_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1
4	B5DF32	0.0	735	719	0.480	0.505	B5DF32_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=2 SV=1
5	G3V926	0.0	736	680	0.481	0.535	G3V926_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=4 SV=2
6	O14920	0.0	1563	756	1.000	1.000	IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
7	O15111	0.0	749	745	0.507	0.514	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
8	O88351	0.0	1447	757	0.919	0.918	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
9	Q4G3H4	0.0	752	758	0.517	0.516	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
10	Q5ZI83	0.0	996	739	0.671	0.686	Q5ZI83_CHICK Protein kinase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_29g15 PE=2 SV=1
11	Q5ZJB4	0.0	752	759	0.493	0.491	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
12	Q60680	0.0	744	745	0.509	0.517	IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus OX=10090 GN=Chuk PE=1 SV=1
13	Q6INT1	0.0	1109	742	0.713	0.726	Q6INT1_XENLA IkappaB kinase OS=Xenopus laevis OX=8355 GN=ikbkb.L PE=1 SV=1
14	Q9QY78	0.0	1440	757	0.914	0.913	IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus OX=10116 GN=Ikbkb PE=1 SV=1
15	Q9VEZ5	1.58e-51	194	751	0.163	0.164	IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster OX=7227 GN=IKKbeta PE=1 SV=2
16	Q14164	4.50e-37	150	716	0.138	0.145	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
17	Q9R0T8	2.05e-35	145	717	0.136	0.144	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
18	Q94C95	1.67e-33	139	626	0.099	0.120	ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1
19	Q0GKD6	2.93e-33	139	727	0.139	0.144	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
20	Q9QY01	5.05e-33	139	1037	0.110	0.080	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	8.7	17.7	Phosphotransferase enzyme family
2	PF03632 Glyco_hydro_65m	2.5e+02	11.9	Glycosyl hydrolase family 65 central catalytic domain
3	PF18397 IKBKB_SDD	1.2e-130	446.4	IQBAL scaffold dimerization domain
4	PF12179 IKKbetaNEMObind	3.4e-13	60.5	I-kappa-kinase-beta NEMO binding domain
5	PF06293 Kdo	0.0021	29.0	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF08612 Med20	1.2e+02	13.5	TATA-binding related factor (TRF) of subunit 20 of Mediator complex
7	PF00069 Pkinase	2.2e-50	183.1	Protein kinase domain
8	PF17667 Pkinase_fungal	5.4e-06	37.1	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	1.9e-34	130.7	Protein tyrosine and serine/threonine kinase
10	PF18396 TBK1_ULD	3.3e+02	12.6	TANK binding kinase 1 ubiquitin-like domain
11	PF00240 ubiquitin	0.49	21.5	Ubiquitin family
12	PF10707 YrbL-PhoP_reg	48	15.0	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430684

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000226574	0.999	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
4	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
5	9606.ENSP00000171111	0.998	Kelch-like ECH-associated protein 1
6	9606.ENSP00000384273	0.998	Transcription factor p65
7	9606.ENSP00000162749	0.997	Tumor necrosis factor receptor superfamily member 1A
8	9606.ENSP00000312988	0.995	NF-kappa-B inhibitor beta
9	9606.ENSP00000335153	0.995	Heat shock protein HSP 90-alpha
10	9606.ENSP00000358983	0.995	Nuclear factor NF-kappa-B p100 subunit
11	9606.ENSP00000359612	0.995	B-cell lymphoma/leukemia 10
12	9606.ENSP00000247668	0.994	TNF receptor-associated factor 2
13	9606.ENSP00000358335	0.993	Mitogen-activated protein kinase kinase kinase 7
14	9606.ENSP00000398698	0.993	Tumor necrosis factor
15	9606.ENSP00000359424	0.992	Inhibitor of nuclear factor kappa-B kinase subunit alpha
16	9606.ENSP00000482657	0.989	Mitogen-activated protein kinase kinase kinase 14
17	9606.ENSP00000263125	0.988	Protein kinase C theta type
18	9606.ENSP00000468263	0.988	ELKS/Rab6-interacting/CAST family member 1
19	9606.ENSP00000216160	0.987	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
20	9606.ENSP00000356426	0.986	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.970	enzyme binding
GO:0042802	0.902	identical protein binding
GO:0019900	0.413	kinase binding
GO:0008384	0.379	IkappaB kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0009987	0.988	cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0007154	0.979	cell communication
GO:0048522	0.972	positive regulation of cellular process
GO:0023052	0.971	signaling
GO:0051716	0.970	cellular response to stimulus
GO:0007165	0.910	signal transduction
GO:0019222	0.891	regulation of metabolic process
GO:0071704	0.881	organic substance metabolic process
GO:0060255	0.881	regulation of macromolecule metabolic process
GO:0048583	0.863	regulation of response to stimulus
GO:0080090	0.861	regulation of primary metabolic process
GO:0051171	0.860	regulation of nitrogen compound metabolic process
GO:0031323	0.860	regulation of cellular metabolic process
GO:0009893	0.830	positive regulation of metabolic process
GO:0044238	0.825	primary metabolic process
GO:0010468	0.772	regulation of gene expression
GO:0048519	0.771	negative regulation of biological process
GO:0036211	0.768	protein modification process
GO:0009966	0.767	regulation of signal transduction
GO:0044237	0.765	cellular metabolic process
GO:0042221	0.723	response to chemical
GO:0048523	0.711	negative regulation of cellular process
GO:0010033	0.704	response to organic substance
GO:0010604	0.702	positive regulation of macromolecule metabolic process
GO:0009889	0.696	regulation of biosynthetic process
GO:0010556	0.694	regulation of macromolecule biosynthetic process
GO:0031326	0.694	regulation of cellular biosynthetic process
GO:0048584	0.603	positive regulation of response to stimulus
GO:0019219	0.598	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.575	positive regulation of nitrogen compound metabolic process
GO:0035556	0.572	intracellular signal transduction
GO:0009605	0.553	response to external stimulus
GO:0016310	0.509	phosphorylation
GO:0051252	0.506	regulation of RNA metabolic process
GO:0065009	0.498	regulation of molecular function
GO:2001141	0.496	regulation of RNA biosynthetic process
GO:0006355	0.492	regulation of DNA-templated transcription
GO:0006468	0.490	protein phosphorylation
GO:0032501	0.484	multicellular organismal process
GO:1902531	0.483	regulation of intracellular signal transduction
GO:0044093	0.473	positive regulation of molecular function
GO:0006950	0.466	response to stress
GO:0051239	0.461	regulation of multicellular organismal process
GO:0031325	0.457	positive regulation of cellular metabolic process
GO:0080134	0.451	regulation of response to stress
GO:0051246	0.450	regulation of protein metabolic process
GO:0002682	0.446	regulation of immune system process
GO:0070887	0.440	cellular response to chemical stimulus
GO:0009967	0.435	positive regulation of signal transduction
GO:0010941	0.418	regulation of cell death
GO:0007166	0.410	cell surface receptor signaling pathway
GO:0043122	0.403	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0071310	0.392	cellular response to organic substance
GO:0032502	0.387	developmental process
GO:1902533	0.379	positive regulation of intracellular signal transduction
GO:0048856	0.369	anatomical structure development
GO:0009892	0.359	negative regulation of metabolic process
GO:0051090	0.348	regulation of DNA-binding transcription factor activity
GO:0002376	0.341	immune system process
GO:0043123	0.328	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050790	0.318	regulation of catalytic activity
GO:0043067	0.317	regulation of programmed cell death
GO:0032101	0.314	regulation of response to external stimulus
GO:0051247	0.311	positive regulation of protein metabolic process
GO:0009607	0.308	response to biotic stimulus
GO:0044419	0.305	biological process involved in interspecies interaction between organisms
GO:0071345	0.305	cellular response to cytokine stimulus
GO:0031399	0.302	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.997	protein-containing complex
GO:0043226	0.861	organelle
GO:0043231	0.840	intracellular membrane-bounded organelle
GO:0016020	0.715	membrane
GO:1990234	0.712	transferase complex
GO:0070013	0.677	intracellular organelle lumen
GO:0005634	0.586	nucleus
GO:0061695	0.545	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.536	serine/threonine protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:19073	0.379	ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein]
EC:2.7.11.10	0.379	IkappaB kinase.

[back to server]