StarFunc result for job id O14924

User Input

>input (1447 residues)
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDP
EGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKR
EWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGTGLTQPSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVARYGLDLSGLLVRLSG
EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVPVKQNTAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ
WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQ
SQEVEAGGIQTVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRD
LPVNRIIDVDLVTGSAPGRDGGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTS
AHHATFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08774	0.318	0.329	0.000	1387	0.807	0.842	O08774.pdb.gz	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
2	AFDB:O14924	1.000	1.000	0.000	1447	1.000	1.000	O14924.pdb.gz	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1
3	AFDB:O43566	0.107	0.256	2.300E-44	566	0.165	0.422	O43566.pdb.gz	RGS14_HUMAN Regulator of G-protein signaling 14 OS=Homo sapiens OX=9606 GN=RGS14 PE=1 SV=4
4	AFDB:O97758	0.064	0.053	1.151E-9	1769	0.144	0.118	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
5	AFDB:A0A1D5NS76	0.059	0.045	2.226E-9	2005	0.143	0.103	A0A1D5NS76.pdb.gz
6	PDB:1agrE	0.084	0.902	2.752E-9	128	0.034	0.383	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
7	AFDB:A1ZAN6	0.066	0.047	8.332E-9	2559	0.144	0.081	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
8	AFDB:P39447	0.062	0.052	9.300E-9	1745	0.151	0.126	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
9	AFDB:Q5TCQ9	0.057	0.056	2.008E-8	1481	0.076	0.074	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
10	AFDB:Q9EQJ9	0.064	0.063	2.502E-8	1476	0.082	0.080	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
11	AFDB:Q5SYB0	0.064	0.060	2.644E-8	1578	0.143	0.131	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
12	PDB:7rbsB	0.056	0.415	3.854E-8	157	0.017	0.159	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:7shfC	0.082	0.292	7.877E-8	400	0.033	0.120	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
14	PDB:6mdhA	0.074	0.430	4.332E-7	149	0.010	0.094	6mdhA.pdb.gz
15	PDB:6yvaC	0.058	0.410	8.854E-7	155	0.015	0.142	6yvaC.pdb.gz
16	PDB:7pcbA	0.054	0.185	2.020E-6	415	0.022	0.077	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7pc3A	0.058	0.201	2.659E-6	405	0.014	0.049	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqnC	0.056	0.187	2.968E-6	414	0.018	0.063	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p70A	0.057	0.197	9.419E-6	407	0.015	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7p73A	0.054	0.181	1.240E-5	420	0.015	0.050	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08774	0.0	2295	1387	0.810	0.845	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
2	O14924	0.0	2957	1447	1.000	1.000	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1
3	Q8CGE9	0.0	2306	1381	0.815	0.854	RGS12_MOUSE Regulator of G-protein signaling 12 OS=Mus musculus OX=10090 GN=Rgs12 PE=1 SV=2
4	O43566	8.61e-112	367	566	0.167	0.428	RGS14_HUMAN Regulator of G-protein signaling 14 OS=Homo sapiens OX=9606 GN=RGS14 PE=1 SV=4
5	P97492	1.17e-110	363	547	0.166	0.439	RGS14_MOUSE Regulator of G-protein signaling 14 OS=Mus musculus OX=10090 GN=Rgs14 PE=1 SV=2
6	O08773	2.40e-110	362	544	0.167	0.445	RGS14_RAT Regulator of G-protein signaling 14 OS=Rattus norvegicus OX=10116 GN=Rgs14 PE=1 SV=1
7	Q7SXC7	4.01e-81	279	532	0.126	0.344	Q7SXC7_DANRE Regulator of G-protein signaling 14 OS=Danio rerio OX=7955 GN=rgs14 PE=2 SV=1
8	Q9VCX1	8.24e-51	200	1541	0.091	0.086	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
9	O43665	3.50e-39	146	181	0.049	0.392	RGS10_HUMAN Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10 PE=1 SV=3
10	P49806	1.17e-37	142	181	0.044	0.354	RGS10_RAT Regulator of G-protein signaling 10 OS=Rattus norvegicus OX=10116 GN=Rgs10 PE=1 SV=2
11	Q9CQE5	1.53e-37	141	181	0.044	0.354	RGS10_MOUSE Regulator of G-protein signaling 10 OS=Mus musculus OX=10090 GN=Rgs10 PE=1 SV=1
12	O08899	1.53e-23	102	205	0.039	0.273	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
13	P49799	2.26e-23	101	205	0.039	0.273	RGS4_RAT Regulator of G-protein signaling 4 OS=Rattus norvegicus OX=10116 GN=Rgs4 PE=1 SV=1
14	O70521	4.39e-23	101	216	0.037	0.250	RGS19_RAT Regulator of G-protein signaling 19 OS=Rattus norvegicus OX=10116 GN=Rgs19 PE=1 SV=1
15	Q9CX84	1.32e-22	100	216	0.037	0.245	RGS19_MOUSE Regulator of G-protein signaling 19 OS=Mus musculus OX=10090 GN=Rgs19 PE=1 SV=1
16	P49798	2.00e-22	99.0	205	0.039	0.273	RGS4_HUMAN Regulator of G-protein signaling 4 OS=Homo sapiens OX=9606 GN=RGS4 PE=1 SV=1
17	Q9UGC6	2.62e-22	99.0	210	0.033	0.229	RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens OX=9606 GN=RGS17 PE=1 SV=2
18	Q9QZB0	1.07e-21	97.1	210	0.033	0.229	RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus OX=10090 GN=Rgs17 PE=1 SV=1
19	P49795	2.72e-21	96.3	217	0.036	0.240	RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens OX=9606 GN=RGS19 PE=1 SV=1
20	A0A8I5ZV65	5.74e-21	95.5	228	0.033	0.211	A0A8I5ZV65_RAT Regulator of G-protein signaling 17 OS=Rattus norvegicus OX=10116 GN=Rgs17 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02188 GoLoco	3.4e-05	34.5	GoLoco motif
2	PF00595 PDZ	1.3e-09	49.6	PDZ domain
3	PF13180 PDZ_2	27	16.6	PDZ domain
4	PF17820 PDZ_6	0.0018	29.4	PDZ domain
5	PF02163 Peptidase_M50	12	16.6	Peptidase family M50
6	PF00640 PID	1.7	20.1	Phosphotyrosine interaction domain (PTB/PID)
7	PF07591 PT-HINT	1.9e+02	13.7	Pretoxin HINT domain
8	PF02196 RBD	1.8e-26	103.1	Raf-like Ras-binding domain
9	PF00615 RGS	2.3e-24	97.3	Regulator of G protein signaling domain
10	PF16613 RGS12_us1	8.3e-50	179.4	Unstructured region of RGS12
11	PF16611 RGS12_us2	2.4e-29	112.8	Unstructured region between RBD and GoLoco
12	PF16612 RGS12_usC	4.3e-53	191.0	C-terminal unstructured region of RGS12
13	PF11470 TUG-UBL1	15	17.1	TUG ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319635	0.962	C-X-C chemokine receptor type 2
2	9606.ENSP00000358867	0.956	Guanine nucleotide-binding protein G(k) subunit alpha
3	9606.ENSP00000343027	0.949	Guanine nucleotide-binding protein G(i) subunit alpha-1
4	9606.ENSP00000386229	0.942	Regulator of G-protein signaling 14
5	9606.ENSP00000363255	0.928	Regulator of G-protein signaling 3
6	9606.ENSP00000355523	0.925	Regulator of G-protein signaling 7
7	9606.ENSP00000380876	0.925	Regulator of G-protein signaling 11
8	9606.ENSP00000451030	0.925	Regulator of G-protein signaling 6
9	9606.ENSP00000397181	0.920	Regulator of G-protein signaling 4
10	9606.ENSP00000297313	0.919	Regulator of G-protein signaling 20
11	9606.ENSP00000356194	0.916	Regulator of G-protein signaling 17
12	9606.ENSP00000356430	0.915	Regulator of G-protein signaling 18
13	9606.ENSP00000442837	0.914	Regulator of G-protein signaling 13
14	9606.ENSP00000378483	0.913	Regulator of G-protein signaling 19
15	9606.ENSP00000356429	0.912	Regulator of G-protein signaling 1
16	9606.ENSP00000356529	0.912	Regulator of G-protein signaling 16
17	9606.ENSP00000258302	0.911	Regulator of G-protein signaling 8
18	9606.ENSP00000262406	0.909	Regulator of G-protein signaling 9
19	9606.ENSP00000358099	0.908	Regulator of G-protein signaling 10
20	9606.ENSP00000428343	0.908	Regulator of G-protein signaling 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	0.997	GTPase activator activity
GO:0003924	0.997	GTPase activity
GO:0001965	0.406	G-protein alpha-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0008277	0.989	regulation of G protein-coupled receptor signaling pathway
GO:0007165	0.987	signal transduction
GO:0007186	0.980	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0031981	0.952	nuclear lumen
GO:0005654	0.879	nucleoplasm
GO:0032991	0.570	protein-containing complex
GO:0030054	0.461	cell junction
GO:0005694	0.407	chromosome
GO:0005730	0.342	nucleolus
GO:0000794	0.338	condensed nuclear chromosome
GO:0042995	0.325	cell projection
GO:0120025	0.324	plasma membrane bounded cell projection
GO:0043005	0.312	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.997	GTP + H2O = GDP + H(+) + phosphate

[back to server]