StarFunc result for job id O14925

User Input

>input (209 residues)
MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEF
ILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMV
TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARG
GLTGLTLTSLYALYNNWEHMKGSLLQQSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14925	1.000	1.000	4.521E-30	209	1.000	1.000	O14925.pdb.gz	TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1
2	AFDB:Q7T2P6	0.674	0.677	5.823E-22	208	0.722	0.726	Q7T2P6.pdb.gz	TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio OX=7955 GN=timm23 PE=2 SV=1
3	AFDB:Q9XVQ2	0.569	0.499	1.123E-7	242	0.239	0.207	Q9XVQ2.pdb.gz	Q9XVQ2_CAEEL Mitochondrial import inner membrane translocase subunit TIM23 OS=Caenorhabditis elegans OX=6239 GN=timm-23 PE=1 SV=1
4	AFDB:Q9USM7	0.539	0.537	3.324E-7	210	0.278	0.276	Q9USM7.pdb.gz	TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim23 PE=3 SV=1
5	AFDB:P32897	0.540	0.511	2.275E-5	222	0.206	0.194	P32897.pdb.gz	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
6	AFDB:Q59YG5	0.536	0.516	2.409E-5	218	0.177	0.170	Q59YG5.pdb.gz	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
7	AFDB:Q94EH2	0.415	0.413	1.105E-3	210	0.163	0.162	Q94EH2.pdb.gz	TI222_ARATH Chloroplastic import inner membrane translocase subunit TIM22-2 OS=Arabidopsis thaliana OX=3702 GN=TIM22-2 PE=1 SV=1
8	AFDB:Q38820	0.518	0.569	1.170E-3	188	0.206	0.229	Q38820.pdb.gz	TI232_ARATH Mitochondrial import inner membrane translocase subunit TIM23-2 OS=Arabidopsis thaliana OX=3702 GN=TIM23-2 PE=1 SV=1
9	AFDB:Q6NKU9	0.416	0.407	2.071E-3	214	0.158	0.154	Q6NKU9.pdb.gz	TI223_ARATH Mitochondrial import inner membrane translocase subunit TIM22-3 OS=Arabidopsis thaliana OX=3702 GN=TIM22-3 PE=2 SV=1
10	AFDB:Q9LN27	0.494	0.476	5.790E-3	218	0.139	0.133	Q9LN27.pdb.gz	TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1 OS=Arabidopsis thaliana OX=3702 GN=TIM17-1 PE=2 SV=1
11	PDB:7cgpA	0.314	0.428	1.850E-2	147	0.144	0.204	7cgpA.pdb.gz
12	PDB:6lo8A	0.321	0.481	3.275E-2	129	0.129	0.209	6lo8A.pdb.gz
13	PDB:3j6bT	0.207	0.207	6.755E-1	209	0.124	0.124	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:6tz402	0.176	0.202	7.572E-1	176	0.077	0.091	6tz402.pdb.gz
15	PDB:6cnnA	0.157	0.100	8.987E-1	360	0.144	0.083	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
16	PDB:7psaY	0.302	0.395	9.515E-1	140	0.110	0.164	7psaY.pdb.gz	Cryo-electron microscopy reveals how acetogenins inhibit mitochondrial respiratory complex I.
17	PDB:7c4jH	0.182	0.162	1.007	242	0.120	0.103	7c4jH.pdb.gz
18	PDB:7lbmY	0.141	0.136	1.684	218	0.077	0.073	7lbmY.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:5z56A	0.118	0.024	1.999	2232	0.115	0.011	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:5z57A	0.118	0.026	1.999	1978	0.115	0.012	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14925	1.26e-151	421	209	1.000	1.000	TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1
2	Q9WTQ8	2.80e-135	379	209	0.962	0.962	TIM23_MOUSE Mitochondrial import inner membrane translocase subunit Tim23 OS=Mus musculus OX=10090 GN=Timm23 PE=1 SV=1
3	O35093	9.68e-135	378	209	0.957	0.957	TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus OX=10116 GN=Timm23 PE=2 SV=1
4	Q7T2P6	2.28e-109	313	208	0.694	0.697	TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio OX=7955 GN=timm23 PE=2 SV=1
5	Q9XVQ2	7.66e-18	80.9	242	0.230	0.198	Q9XVQ2_CAEEL Mitochondrial import inner membrane translocase subunit TIM23 OS=Caenorhabditis elegans OX=6239 GN=timm-23 PE=1 SV=1
6	Q9USM7	1.20e-13	68.9	210	0.249	0.248	TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim23 PE=3 SV=1
7	P32897	2.20e-10	60.1	222	0.249	0.234	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
8	Q59YG5	2.19e-09	57.4	218	0.148	0.142	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
9	Q9LNQ1	3.40e-05	45.1	187	0.182	0.203	TI231_ARATH Mitochondrial import inner membrane translocase subunit TIM23-1 OS=Arabidopsis thaliana OX=3702 GN=TIM23-1 PE=2 SV=1
10	Q38820	0.002	39.7	188	0.163	0.181	TI232_ARATH Mitochondrial import inner membrane translocase subunit TIM23-2 OS=Arabidopsis thaliana OX=3702 GN=TIM23-2 PE=1 SV=1
11	P87146	0.050	35.8	175	0.129	0.154	TIM22_SCHPO Mitochondrial import inner membrane translocase subunit tim22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim22 PE=3 SV=1
12	A2RVP7	0.14	34.3	173	0.072	0.087	TI221_ARATH Mitochondrial import inner membrane translocase subunit TIM22-1 OS=Arabidopsis thaliana OX=3702 GN=TIM22-1 PE=1 SV=1
13	Q9Y584	0.19	34.3	194	0.148	0.160	TIM22_HUMAN Mitochondrial import inner membrane translocase subunit Tim22 OS=Homo sapiens OX=9606 GN=TIMM22 PE=1 SV=2
14	A0A1D8PI78	0.27	33.5	184	0.086	0.098	TIM22_CANAL Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM22 PE=1 SV=1
15	Q59TD5	0.65	33.1	490	0.124	0.053	Q59TD5_CANAL NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NDH51 PE=3 SV=1
16	Q9CQ85	2.2	30.8	194	0.105	0.113	TIM22_MOUSE Mitochondrial import inner membrane translocase subunit Tim22 OS=Mus musculus OX=10090 GN=Timm22 PE=1 SV=1
17	Q9V4C8	3.4	31.2	1500	0.067	0.009	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2
18	Q12328	3.5	30.4	207	0.077	0.077	TIM22_YEAST Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM22 PE=1 SV=1
19	Q9W040	3.8	30.8	1754	0.096	0.011	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
20	F4JI18	5.2	30.0	300	0.072	0.050	F4JI18_ARATH TRAF-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g01390 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02466 Tim17	6e-16	70.2	Tim17/Tim22/Tim23/Pmp24 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010368645.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010383403.1	0.996	Mitochondrial import inner membrane translocase subunit TIM44
2	61622.XP_010352228.1	0.995	Presequence translocase associated motor 16 homolog
3	61622.XP_010360871.1	0.995	Mitochondrial import inner membrane translocase subunit Tim17-B isoform X1
4	61622.XP_010355003.1	0.994	Translocase of inner mitochondrial membrane 21
5	61622.XP_010377158.1	0.993	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
6	61622.XP_010379204.1	0.991	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
7	61622.XP_010387551.1	0.985	Translocase of outer mitochondrial membrane 22
8	61622.XP_010350834.1	0.980	DnaJ heat shock protein family (Hsp40) member C19
9	61622.XP_010368330.1	0.973	Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner
10	61622.XP_010357948.1	0.971	Mitochondrial import inner membrane translocase subunit Tim8 A isoform X1
11	61622.XP_010366369.1	0.971	DnaJ heat shock protein family (Hsp40) member C15
12	61622.XP_010384855.1	0.971	Reactive oxygen species modulator 1
13	61622.XP_010386405.1	0.970	Heat shock protein family A (Hsp70) member 9
14	61622.XP_010371785.1	0.969	Mitochondrial import inner membrane translocase subunit Tim22
15	61622.XP_010373151.1	0.956	Mitochondrial import inner membrane translocase subunit Tim13
16	61622.XP_010375448.1	0.956	Mitochondrial import inner membrane translocase subunit Tim13
17	61622.XP_010385153.1	0.936	Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner
18	61622.XP_010385173.1	0.936	grpE protein homolog 2, mitochondrial-like
19	61622.XP_010351699.1	0.932	Mitochondrial import inner membrane translocase subunit Tim10
20	61622.XP_010357555.1	0.928	Mitochondrial import inner membrane translocase subunit Tim8 B-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.712	transporter activity
GO:0022857	0.651	transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0072594	0.980	establishment of protein localization to organelle
GO:0070585	0.977	protein localization to mitochondrion
GO:0071840	0.972	cellular component organization or biogenesis
GO:0016043	0.964	cellular component organization
GO:0006605	0.956	protein targeting
GO:0072655	0.947	establishment of protein localization to mitochondrion
GO:0006839	0.938	mitochondrial transport
GO:0007005	0.935	mitochondrion organization
GO:0006626	0.934	protein targeting to mitochondrion
GO:0065007	0.453	biological regulation
GO:0050789	0.443	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0032991	0.989	protein-containing complex
GO:0070013	0.984	intracellular organelle lumen
GO:0098798	0.926	mitochondrial protein-containing complex
GO:0098796	0.900	membrane protein complex
GO:0098800	0.890	inner mitochondrial membrane protein complex
GO:0005758	0.665	mitochondrial intermembrane space
GO:0005744	0.531	TIM23 mitochondrial import inner membrane translocase complex
GO:0031981	0.341	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]