StarFunc result for job id O14944

User Input

>input (169 residues)
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14944	1.000	1.000	1.469E-30	169	1.000	1.000	O14944.pdb.gz	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
2	AFDB:Q61521	0.567	0.587	2.955E-21	162	0.751	0.784	Q61521.pdb.gz	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
3	AFDB:Q05928	0.363	0.351	4.628E-9	177	0.254	0.243	Q05928.pdb.gz	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
4	AFDB:Q64EU6	0.406	0.403	1.729E-8	171	0.213	0.211	Q64EU6.pdb.gz	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
5	AFDB:P35070	0.393	0.376	3.571E-8	178	0.219	0.208	P35070.pdb.gz	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
6	AFDB:P07522	0.252	0.049	2.271E-6	1133	0.213	0.032	P07522.pdb.gz	EGF_RAT Pro-epidermal growth factor OS=Rattus norvegicus OX=10116 GN=Egf PE=1 SV=2
7	AFDB:Q6J1M9	0.325	0.349	2.426E-6	156	0.195	0.212	Q6J1M9.pdb.gz	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
8	AFDB:P01135	0.303	0.317	3.373E-6	160	0.183	0.194	P01135.pdb.gz	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
9	AFDB:Q924X1	0.361	0.395	4.390E-6	152	0.249	0.276	Q924X1.pdb.gz	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
10	AFDB:Q8IYR6	0.406	0.196	5.009E-6	380	0.148	0.066	Q8IYR6.pdb.gz	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
11	PDB:3t5oA	0.166	0.034	1.060	871	0.047	0.009	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
12	PDB:7nycD	0.161	0.058	1.132	487	0.059	0.021	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:7nycC	0.184	0.041	1.379	809	0.053	0.011	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:6h03C	0.159	0.057	1.574	513	0.059	0.019	6h03C.pdb.gz
15	PDB:7q3nU	0.125	0.076	2.049	292	0.041	0.024	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
16	PDB:4rs0A	0.194	0.062	2.337	557	0.053	0.016	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
17	PDB:5es4B	0.094	0.024	2.848	674	0.047	0.012	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
18	PDB:3ojyB	0.153	0.054	3.250	504	0.053	0.018	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
19	PDB:7cunI	0.115	0.044	3.471	624	0.041	0.011	7cunI.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
20	PDB:2hoxD	0.157	0.066	3.708	427	0.047	0.019	2hoxD.pdb.gz	Two Structures of Alliinase from Alliium sativum L.: Apo Form and Ternary Complex with Aminoacrylate Reaction Intermediate Covalently Bound to the PLP Cofactor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14944	8.35e-126	352	169	1.000	1.000	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
2	Q61521	1.20e-94	273	162	0.781	0.815	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
3	Q9Z0L5	1.02e-93	270	162	0.775	0.809	EREG_RAT Proepiregulin OS=Rattus norvegicus OX=10116 GN=Ereg PE=1 SV=1
4	Q924X1	2.31e-10	58.2	152	0.284	0.316	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
5	A0A8I5ZSF9	1.32e-08	53.9	193	0.207	0.181	A0A8I5ZSF9_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
6	A0A8I6AQ55	1.82e-08	53.5	199	0.166	0.141	A0A8I6AQ55_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
7	P01134	2.99e-08	52.4	159	0.201	0.214	TGFA_RAT Protransforming growth factor alpha OS=Rattus norvegicus OX=10116 GN=Tgfa PE=1 SV=2
8	P48030	3.67e-08	52.4	159	0.166	0.176	TGFA_MOUSE Protransforming growth factor alpha OS=Mus musculus OX=10090 GN=Tgfa PE=1 SV=1
9	Q9JJM4	3.91e-08	52.4	177	0.166	0.158	Q9JJM4_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=2 SV=1
10	A0A8J8YRH0	4.79e-08	52.4	191	0.172	0.152	A0A8J8YRH0_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
11	Q6UW88	7.16e-08	51.2	154	0.160	0.175	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
12	Q64EU6	1.39e-07	50.8	171	0.160	0.158	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
13	Q8IYR6	6.50e-07	50.1	380	0.172	0.076	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
14	Q9UIK5	7.53e-07	50.1	374	0.148	0.067	TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens OX=9606 GN=TMEFF2 PE=1 SV=1
15	P01135	2.07e-06	47.4	160	0.183	0.194	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
16	Q05928	4.24e-06	47.0	177	0.166	0.158	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
17	Q8WWG1	9.48e-06	44.7	115	0.124	0.183	NRG4_HUMAN Pro-neuregulin-4, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG4 PE=1 SV=1
18	Q9W7C5	2.06e-05	45.1	212	0.130	0.104	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
19	P31955	4.81e-05	44.3	248	0.095	0.065	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
20	P01133	4.88e-05	45.1	1207	0.183	0.026	EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02028 BCCT	1.1e+02	12.7	BCCT, betaine/carnitine/choline family transporter
2	PF06365 CD34_antigen	1.9e+02	13.1	CD34/Podocalyxin family
3	PF20207 DUF6568	5.6e+02	11.7	Family of unknown function (DUF6568)
4	PF00008 EGF	3	19.6	EGF-like domain
5	PF13800 Sigma_reg_N	3.3e+02	13.0	Sigma factor regulator N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000267101	0.983	Receptor tyrosine-protein kinase erbB-3
3	9606.ENSP00000342235	0.983	Receptor tyrosine-protein kinase erbB-4
4	9606.ENSP00000269571	0.963	Receptor tyrosine-protein kinase erbB-2
5	9606.ENSP00000309968	0.956	Disintegrin and metalloproteinase domain-containing protein 17
6	9606.ENSP00000256078	0.954	GTPase KRas
7	9606.ENSP00000407586	0.954	GTPase HRas
8	9606.ENSP00000379097	0.942	Amphiregulin
9	9606.ENSP00000306245	0.922	Proto-oncogene c-Fos
10	9606.ENSP00000273261	0.918	Leucine-rich repeats and immunoglobulin-like domains protein 1
11	9606.ENSP00000426632	0.915	Erbin
12	9606.ENSP00000358548	0.913	GTPase NRas
13	9606.ENSP00000248594	0.910	Tyrosine-protein phosphatase non-receptor type 12
14	9606.ENSP00000335153	0.908	Heat shock protein HSP 90-alpha
15	9606.ENSP00000462468	0.903	Tyrosine-protein kinase Yes
16	9606.ENSP00000220003	0.902	Tyrosine-protein kinase CSK
17	9606.ENSP00000357196	0.902	Receptor-type tyrosine-protein phosphatase kappa
18	9606.ENSP00000267257	0.901	Paxillin
19	9606.ENSP00000220597	0.900	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
20	9606.ENSP00000222005	0.900	Hsp90 co-chaperone Cdc37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0048018	1.000	receptor ligand activity
GO:0030297	0.999	transmembrane receptor protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.985	positive regulation of cellular process
GO:0007165	0.985	signal transduction
GO:0008284	0.962	positive regulation of cell population proliferation
GO:0032502	0.960	developmental process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0043549	0.952	regulation of kinase activity
GO:0048856	0.950	anatomical structure development
GO:0007166	0.949	cell surface receptor signaling pathway
GO:0009893	0.946	positive regulation of metabolic process
GO:0080090	0.944	regulation of primary metabolic process
GO:0007169	0.944	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010604	0.938	positive regulation of macromolecule metabolic process
GO:0038127	0.930	ERBB signaling pathway
GO:0051128	0.908	regulation of cellular component organization
GO:0048519	0.906	negative regulation of biological process
GO:0001934	0.905	positive regulation of protein phosphorylation
GO:0051347	0.903	positive regulation of transferase activity
GO:0006275	0.902	regulation of DNA replication
GO:0048584	0.894	positive regulation of response to stimulus
GO:0051239	0.890	regulation of multicellular organismal process
GO:0051130	0.887	positive regulation of cellular component organization
GO:0048523	0.882	negative regulation of cellular process
GO:0010468	0.871	regulation of gene expression
GO:0071704	0.861	organic substance metabolic process
GO:0048513	0.857	animal organ development
GO:0033043	0.843	regulation of organelle organization
GO:0050678	0.842	regulation of epithelial cell proliferation
GO:0044237	0.841	cellular metabolic process
GO:0007173	0.841	epidermal growth factor receptor signaling pathway
GO:0045935	0.832	positive regulation of nucleobase-containing compound metabolic process
GO:0050793	0.822	regulation of developmental process
GO:0033674	0.821	positive regulation of kinase activity
GO:0045840	0.818	positive regulation of mitotic nuclear division
GO:0051054	0.806	positive regulation of DNA metabolic process
GO:0051240	0.804	positive regulation of multicellular organismal process
GO:0006807	0.775	nitrogen compound metabolic process
GO:0042221	0.747	response to chemical
GO:0044238	0.744	primary metabolic process
GO:0045740	0.743	positive regulation of DNA replication
GO:0009889	0.731	regulation of biosynthetic process
GO:0010628	0.723	positive regulation of gene expression
GO:0045859	0.701	regulation of protein kinase activity
GO:0009653	0.682	anatomical structure morphogenesis
GO:0030154	0.648	cell differentiation
GO:0032501	0.633	multicellular organismal process
GO:0043170	0.631	macromolecule metabolic process
GO:0009888	0.592	tissue development
GO:0045860	0.559	positive regulation of protein kinase activity
GO:0023051	0.551	regulation of signaling
GO:0010646	0.551	regulation of cell communication
GO:0009966	0.528	regulation of signal transduction
GO:0034641	0.524	cellular nitrogen compound metabolic process
GO:0010033	0.515	response to organic substance
GO:0008283	0.512	cell population proliferation
GO:0048145	0.497	regulation of fibroblast proliferation
GO:0050673	0.479	epithelial cell proliferation
GO:0009887	0.445	animal organ morphogenesis
GO:0009967	0.436	positive regulation of signal transduction
GO:0070887	0.392	cellular response to chemical stimulus
GO:0007275	0.381	multicellular organism development
GO:1902531	0.380	regulation of intracellular signal transduction
GO:0008285	0.357	negative regulation of cell population proliferation
GO:0071310	0.339	cellular response to organic substance
GO:0071840	0.325	cellular component organization or biogenesis
GO:0009892	0.321	negative regulation of metabolic process
GO:0031326	0.314	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0016020	0.986	membrane
GO:0005886	0.983	plasma membrane
GO:0005737	0.981	cytoplasm
GO:0043227	0.976	membrane-bounded organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0031090	0.954	organelle membrane
GO:0031982	0.949	vesicle
GO:0098588	0.940	bounding membrane of organelle
GO:0031410	0.934	cytoplasmic vesicle
GO:0030659	0.918	cytoplasmic vesicle membrane
GO:0030669	0.707	clathrin-coated endocytic vesicle membrane
GO:0005829	0.442	cytosol
GO:0012505	0.336	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]