StarFunc result for job id O14958

User Input

>input (399 residues)
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPV
SSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYK
AFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEF
VKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12637	0.900	0.876	2.173E-76	410	0.940	0.915	P12637.pdb.gz	CASQ2_CANLF Calsequestrin-2 OS=Canis lupus familiaris OX=9615 GN=CASQ2 PE=1 SV=1
2	AFDB:O09161	0.907	0.872	4.058E-73	415	0.877	0.843	O09161.pdb.gz	CASQ2_MOUSE Calsequestrin-2 OS=Mus musculus OX=10090 GN=Casq2 PE=1 SV=3
3	AFDB:F1NQT9	0.905	0.889	6.325E-70	406	0.789	0.776	F1NQT9.pdb.gz	F1NQT9_CHICK Calsequestrin OS=Gallus gallus OX=9031 GN=CASQ2 PE=3 SV=1
4	PDB:7f05C	0.862	0.967	2.382E-69	355	0.885	0.994	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
5	AFDB:P19633	0.925	0.909	8.628E-66	406	0.652	0.640	P19633.pdb.gz	CASQ1_RAT Calsequestrin-1 OS=Rattus norvegicus OX=10116 GN=Casq1 PE=1 SV=2
6	AFDB:C0KTH7	0.893	0.842	1.108E-61	424	0.622	0.585	C0KTH7.pdb.gz	C0KTH7_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:Q7T138	0.891	0.619	1.479E-60	579	0.589	0.406	Q7T138.pdb.gz
8	PDB:5crgA	0.866	0.974	1.669E-60	354	0.607	0.684	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
9	AFDB:F6P0J3	0.864	0.761	9.455E-59	454	0.589	0.518	F6P0J3.pdb.gz	F6P0J3_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
10	AFDB:Q20203	0.783	0.751	5.400E-34	417	0.301	0.288	Q20203.pdb.gz	Q20203_CAEEL Calsequestrin OS=Caenorhabditis elegans OX=6239 GN=csq-1 PE=1 SV=1
11	AFDB:Q4WH99	0.537	0.438	1.324E-23	517	0.203	0.157	Q4WH99.pdb.gz	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
12	AFDB:P54399	0.444	0.376	1.586E-23	496	0.188	0.151	P54399.pdb.gz	PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster OX=7227 GN=Pdi PE=2 SV=1
13	PDB:4ekzA	0.490	0.433	3.595E-21	469	0.180	0.154	4ekzA.pdb.gz
14	PDB:5gu6A	0.525	0.548	4.460E-19	377	0.158	0.167	5gu6A.pdb.gz
15	PDB:3f8uA	0.572	0.500	7.131E-18	469	0.150	0.128	3f8uA.pdb.gz
16	PDB:2r2jA	0.448	0.517	2.528E-17	328	0.155	0.189	2r2jA.pdb.gz
17	PDB:3apoA	0.316	0.207	7.289E-15	688	0.120	0.070	3apoA.pdb.gz
18	PDB:4f9zA	0.293	0.475	5.060E-10	219	0.075	0.137	4f9zA.pdb.gz
19	PDB:3ed3A	0.247	0.356	1.905E-9	267	0.073	0.109	3ed3A.pdb.gz
20	PDB:7scdA	0.224	0.240	1.704E-5	371	0.075	0.081	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NQT9	0.0	605	406	0.757	0.744	F1NQT9_CHICK Calsequestrin OS=Gallus gallus OX=9031 GN=CASQ2 PE=3 SV=1
2	O09161	0.0	694	415	0.847	0.814	CASQ2_MOUSE Calsequestrin-2 OS=Mus musculus OX=10090 GN=Casq2 PE=1 SV=3
3	O14958	0.0	796	399	1.000	1.000	CASQ2_HUMAN Calsequestrin-2 OS=Homo sapiens OX=9606 GN=CASQ2 PE=1 SV=2
4	P07221	0.0	523	395	0.619	0.625	CASQ1_RABIT Calsequestrin-1 OS=Oryctolagus cuniculus OX=9986 GN=CASQ1 PE=1 SV=1
5	P12637	0.0	697	410	0.887	0.863	CASQ2_CANLF Calsequestrin-2 OS=Canis lupus familiaris OX=9615 GN=CASQ2 PE=1 SV=1
6	P19204	0.0	604	406	0.754	0.741	CASQ2_CHICK Calsequestrin-2 OS=Gallus gallus OX=9031 GN=CASQ2 PE=1 SV=1
7	P19633	0.0	510	406	0.634	0.623	CASQ1_RAT Calsequestrin-1 OS=Rattus norvegicus OX=10116 GN=Casq1 PE=1 SV=2
8	P31235	0.0	697	409	0.887	0.866	CASQ2_RABIT Calsequestrin-2 OS=Oryctolagus cuniculus OX=9986 GN=CASQ2 PE=1 SV=1
9	P31415	0.0	520	396	0.612	0.616	CASQ1_HUMAN Calsequestrin-1 OS=Homo sapiens OX=9606 GN=CASQ1 PE=1 SV=3
10	P51868	0.0	678	413	0.855	0.826	CASQ2_RAT Calsequestrin-2 OS=Rattus norvegicus OX=10116 GN=Casq2 PE=1 SV=2
11	A0A060WP64	4.74e-179	506	419	0.589	0.561	A0A060WP64_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00042044001 PE=3 SV=1
12	O09165	5.81e-179	506	405	0.624	0.615	CASQ1_MOUSE Calsequestrin-1 OS=Mus musculus OX=10090 GN=Casq1 PE=1 SV=3
13	C0KTH8	8.57e-178	503	410	0.584	0.568	C0KTH8_ONCMY Calsequestrin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	C0KTH7	1.12e-177	503	424	0.581	0.547	C0KTH7_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	C0KTH9	2.50e-177	502	418	0.586	0.560	C0KTH9_ONCMY Calsequestrin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
16	Q08BX6	5.82e-159	456	443	0.551	0.497	Q08BX6_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
17	A0A0R4IKE0	2.66e-153	446	553	0.554	0.400	A0A0R4IKE0_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=bZ1G18.2 PE=1 SV=2
18	F6P0J3	1.01e-152	441	454	0.544	0.478	F6P0J3_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
19	O18934	3.87e-104	306	160	0.378	0.944	CASQ2_PIG Calsequestrin-2 (Fragment) OS=Sus scrofa OX=9823 GN=CASQ2 PE=2 SV=1
20	Q20203	2.29e-48	171	417	0.286	0.273	Q20203_CAEEL Calsequestrin OS=Caenorhabditis elegans OX=6239 GN=csq-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01216 Calsequestrin	4.1e-229	771.8	Calsequestrin
2	PF13848 Thioredoxin_6	3.3e-17	74.4	Thioredoxin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439281	0.999	Triadin
2	9606.ENSP00000355533	0.995	Ryanodine receptor 2
3	9606.ENSP00000368767	0.984	Aspartyl/asparaginyl beta-hydroxylase
4	9606.ENSP00000401437	0.840	LIM domain-binding protein 3
5	9606.ENSP00000467141	0.835	Titin
6	9606.ENSP00000352608	0.832	Ryanodine receptor 1
7	9606.ENSP00000306997	0.819	Myozenin-2
8	9606.ENSP00000357057	0.816	Calsequestrin-1
9	9606.ENSP00000360762	0.786	Ankyrin repeat domain-containing protein 1
10	9606.ENSP00000362071	0.776	Junctophilin-2
11	9606.ENSP00000341940	0.767	Caveolin-3
12	9606.ENSP00000373884	0.747	Ryanodine receptor 3
13	9606.ENSP00000262113	0.743	Myomesin-2
14	9606.ENSP00000378289	0.743	Synaptopodin 2-like protein
15	9606.ENSP00000243457	0.722	Inward rectifier potassium channel 2
16	9606.ENSP00000370373	0.720	Peptidyl-prolyl cis-trans isomerase FKBP1B
17	9606.ENSP00000394770	0.711	Cardiomyopathy-associated protein 5
18	9606.ENSP00000440045	0.696	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
19	9606.ENSP00000411932	0.693	Leiomodin-2
20	9606.ENSP00000410257	0.691	Sodium channel protein type 5 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0010880	0.990	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0044092	0.987	negative regulation of molecular function
GO:0034763	0.987	negative regulation of transmembrane transport
GO:0032409	0.986	regulation of transporter activity
GO:1904063	0.979	negative regulation of cation transmembrane transport
GO:0032413	0.976	negative regulation of ion transmembrane transporter activity
GO:1901020	0.966	negative regulation of calcium ion transmembrane transporter activity
GO:2001258	0.962	negative regulation of cation channel activity
GO:0006937	0.951	regulation of muscle contraction
GO:0023052	0.950	signaling
GO:0007154	0.944	cell communication
GO:0008016	0.944	regulation of heart contraction
GO:0051716	0.923	cellular response to stimulus
GO:0006942	0.920	regulation of striated muscle contraction
GO:0055117	0.910	regulation of cardiac muscle contraction
GO:0048518	0.880	positive regulation of biological process
GO:0019722	0.843	calcium-mediated signaling
GO:0048522	0.836	positive regulation of cellular process
GO:0032501	0.826	multicellular organismal process
GO:0071840	0.580	cellular component organization or biogenesis
GO:0003008	0.540	system process
GO:0016043	0.508	cellular component organization
GO:0006936	0.481	muscle contraction
GO:0002027	0.467	regulation of heart rate
GO:0051179	0.465	localization
GO:0032502	0.418	developmental process
GO:0048856	0.414	anatomical structure development
GO:0008015	0.406	blood circulation
GO:0006941	0.406	striated muscle contraction
GO:0042391	0.396	regulation of membrane potential
GO:0044085	0.353	cellular component biogenesis
GO:0022607	0.335	cellular component assembly
GO:0060048	0.330	cardiac muscle contraction
GO:0030029	0.310	actin filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.997	endoplasmic reticulum
GO:0016529	0.990	sarcoplasmic reticulum
GO:0032991	0.937	protein-containing complex
GO:0016020	0.814	membrane
GO:0098827	0.613	endoplasmic reticulum subcompartment
GO:0070013	0.553	intracellular organelle lumen
GO:0043232	0.461	intracellular non-membrane-bounded organelle
GO:0043292	0.446	contractile fiber
GO:0030016	0.443	myofibril
GO:0030017	0.387	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]