StarFunc result for job id O14974

User Input

>input (1030 residues)
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSVNEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTP
SSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDR
YDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q10728	0.420	0.419	0.000	1032	0.942	0.940	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
2	AFDB:Q90623	0.367	0.376	2.901E-95	1004	0.838	0.860	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
3	AFDB:Q6DRG7	0.446	0.439	7.292E-81	1049	0.737	0.724	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
4	AFDB:F8VZN8	0.325	0.477	2.025E-75	692	0.671	0.999	F8VZN8.pdb.gz	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
5	AFDB:O60237	0.346	0.361	1.095E-54	982	0.458	0.481	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
6	AFDB:G5EG29	0.280	0.297	6.016E-37	968	0.267	0.284	G5EG29.pdb.gz	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
7	AFDB:G5EGT0	0.276	0.279	8.073E-36	1019	0.274	0.277	G5EGT0.pdb.gz	G5EGT0_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
8	AFDB:Q86RA0	0.280	0.311	2.813E-35	927	0.315	0.350	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
9	AFDB:M9PCQ3	0.296	0.276	7.638E-35	1111	0.310	0.287	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	AFDB:G5ECD7	0.285	0.263	8.872E-35	1124	0.287	0.263	G5ECD7.pdb.gz	G5ECD7_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
11	PDB:2dvwA	0.112	0.456	5.411E-13	229	0.072	0.323	2dvwA.pdb.gz
12	PDB:8cs9A	0.104	0.133	1.623E-12	796	0.075	0.097	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:1wg0A	0.122	0.444	1.190E-10	243	0.058	0.247	1wg0A.pdb.gz
14	PDB:4oauC	0.113	0.162	6.831E-10	692	0.068	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6jd6B	0.100	0.445	3.922E-9	192	0.047	0.250	6jd6B.pdb.gz
16	PDB:6v9hC	0.112	0.393	5.035E-9	270	0.055	0.211	6v9hC.pdb.gz
17	PDB:5vkqA	0.110	0.086	1.065E-8	1499	0.054	0.037	5vkqA.pdb.gz
18	PDB:6mwqA	0.095	0.194	3.358E-8	493	0.057	0.120	6mwqA.pdb.gz
19	PDB:6aunA	0.109	0.177	1.053E-6	618	0.057	0.095	6aunA.pdb.gz
20	PDB:1bu9A	0.095	0.521	2.461E-6	168	0.048	0.292	1bu9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1BC59	0.0	2055	1028	0.978	0.980	E1BC59_BOVIN Protein phosphatase 1 regulatory subunit OS=Bos taurus OX=9913 GN=PPP1R12A PE=4 SV=3
2	F8VZN8	0.0	1052	692	0.589	0.877	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
3	O14974	0.0	2099	1030	1.000	1.000	MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
4	O60237	0.0	796	982	0.498	0.522	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
5	Q10728	0.0	1589	1032	0.937	0.935	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
6	Q6DRG7	0.0	792	1049	0.437	0.429	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
7	Q8BG95	0.0	763	976	0.486	0.513	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
8	Q90623	0.0	1385	1004	0.822	0.844	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
9	Q9DBR7	0.0	1541	1029	0.926	0.927	MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus OX=10090 GN=Ppp1r12a PE=1 SV=2
10	H0YIM2	2.37e-107	333	188	0.162	0.888	H0YIM2_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
11	M9NFZ0	3.51e-100	320	341	0.156	0.472	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
12	Q9VUX6	1.16e-98	333	860	0.156	0.187	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
13	A8JNT5	1.56e-98	331	795	0.156	0.203	A8JNT5_DROME Myosin binding subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
14	Q86R99	1.63e-98	331	797	0.156	0.202	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
15	M9PCQ3	5.25e-98	336	1111	0.156	0.145	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
16	Q8IQN4	6.53e-98	337	1144	0.156	0.141	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
17	Q8MT32	6.93e-98	337	1144	0.156	0.141	Q8MT32_DROME RE63915p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
18	Q8MV37	8.56e-98	335	1101	0.156	0.146	Q8MV37_DROME Myosin binding subunit of myosin phosphatase OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
19	A8JNT4	1.66e-97	331	925	0.156	0.174	A8JNT4_DROME Myosin binding subunit, isoform H OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
20	Q86RA0	1.76e-97	331	927	0.156	0.174	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.9e-23	92.5	Ankyrin repeat
2	PF12796 Ank_2	6.3e-32	121.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.9e-20	81.1	Ankyrin repeat
4	PF13637 Ank_4	9e-32	120.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.2e-26	103.7	Ankyrin repeats (many copies)
6	PF15898 PRKG1_interact	5.5e-31	118.7	cGMP-dependent protein kinase interacting domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.999	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000378769	0.999	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
3	9606.ENSP00000400175	0.998	Transforming protein RhoA
4	9606.ENSP00000382697	0.996	Rho-associated protein kinase 1
5	9606.ENSP00000301242	0.991	Protein phosphatase 1 regulatory subunit 14A
6	9606.ENSP00000363092	0.990	cGMP-dependent protein kinase 1
7	9606.ENSP00000300093	0.989	Serine/threonine-protein kinase PLK1
8	9606.ENSP00000317985	0.989	Rho-associated protein kinase 2
9	9606.ENSP00000279022	0.981	Myosin regulatory light polypeptide 9
10	9606.ENSP00000463559	0.971	Myosin regulatory light chain 12B
11	9606.ENSP00000228841	0.969	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
12	9606.ENSP00000326031	0.963	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
13	9606.ENSP00000379156	0.961	Myosin phosphatase Rho-interacting protein
14	9606.ENSP00000285735	0.959	Rho-related GTP-binding protein RhoC
15	9606.ENSP00000478767	0.959	Neurabin-2
16	9606.ENSP00000446955	0.954	Myosin light polypeptide 6
17	9606.ENSP00000272233	0.951	Rho-related GTP-binding protein RhoB
18	9606.ENSP00000353452	0.948	Myosin light chain kinase, smooth muscle
19	9606.ENSP00000216181	0.945	Myosin-9
20	9606.ENSP00000217652	0.943	Myosin regulatory light chain 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.979	molecular function regulator activity
GO:0003824	0.933	catalytic activity
GO:0140096	0.598	catalytic activity, acting on a protein
GO:0016787	0.317	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.997	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0008152	0.983	metabolic process
GO:0050896	0.963	response to stimulus
GO:0048518	0.950	positive regulation of biological process
GO:0019222	0.947	regulation of metabolic process
GO:0071704	0.945	organic substance metabolic process
GO:0044237	0.943	cellular metabolic process
GO:0044238	0.939	primary metabolic process
GO:0006807	0.937	nitrogen compound metabolic process
GO:0016311	0.934	dephosphorylation
GO:0048522	0.930	positive regulation of cellular process
GO:0006470	0.917	protein dephosphorylation
GO:0051716	0.877	cellular response to stimulus
GO:0031323	0.867	regulation of cellular metabolic process
GO:0042221	0.866	response to chemical
GO:0060255	0.731	regulation of macromolecule metabolic process
GO:0060341	0.719	regulation of cellular localization
GO:0070887	0.713	cellular response to chemical stimulus
GO:0080090	0.705	regulation of primary metabolic process
GO:0051171	0.702	regulation of nitrogen compound metabolic process
GO:0009893	0.656	positive regulation of metabolic process
GO:0071840	0.623	cellular component organization or biogenesis
GO:0016043	0.557	cellular component organization
GO:0032501	0.553	multicellular organismal process
GO:0032386	0.481	regulation of intracellular transport
GO:0051246	0.460	regulation of protein metabolic process
GO:0031325	0.453	positive regulation of cellular metabolic process
GO:0046822	0.430	regulation of nucleocytoplasmic transport
GO:0010033	0.420	response to organic substance
GO:0065009	0.418	regulation of molecular function
GO:0048856	0.417	anatomical structure development
GO:1901700	0.392	response to oxygen-containing compound
GO:1901698	0.378	response to nitrogen compound
GO:0019220	0.349	regulation of phosphate metabolic process
GO:0010604	0.337	positive regulation of macromolecule metabolic process
GO:0051173	0.320	positive regulation of nitrogen compound metabolic process
GO:0007010	0.316	cytoskeleton organization
GO:0007154	0.310	cell communication
GO:0023052	0.309	signaling
GO:0048519	0.305	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0043227	0.915	membrane-bounded organelle
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0016020	0.731	membrane
GO:0005634	0.706	nucleus
GO:0031974	0.582	membrane-enclosed lumen
GO:0005886	0.579	plasma membrane
GO:0031981	0.557	nuclear lumen
GO:0005654	0.507	nucleoplasm
GO:0005856	0.339	cytoskeleton
GO:0099081	0.305	supramolecular polymer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.317	Hydrolases.

[back to server]