StarFunc result for job id O14977

User Input

>input (448 residues)
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQI
KYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDSMMKNFFFVPSCIQLSQEDSFSAEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14977	1.000	1.000	3.700E-99	448	1.000	1.000	O14977.pdb.gz	AZIN1_HUMAN Antizyme inhibitor 1 OS=Homo sapiens OX=9606 GN=AZIN1 PE=1 SV=2
2	PDB:3btnA	0.874	0.993	2.297E-74	394	0.842	0.957	3btnA.pdb.gz
3	AFDB:P00860	0.832	0.809	6.365E-57	461	0.498	0.484	P00860.pdb.gz	DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus OX=10090 GN=Odc1 PE=1 SV=2
4	PDB:2oo0A	0.835	0.891	2.272E-56	419	0.482	0.516	2oo0A.pdb.gz	A structural insight into the inhibition of human and Leishmania donovani ornithine decarboxylases by 1-amino-oxy-3-aminopropane.
5	AFDB:Q9DGJ4	0.833	0.811	2.455E-56	461	0.475	0.462	Q9DGJ4.pdb.gz	Q9DGJ4_DANRE Odc1 protein OS=Danio rerio OX=7955 GN=wu:fc54f04 PE=2 SV=1
6	AFDB:Q96A70	0.854	0.833	4.494E-53	460	0.435	0.424	Q96A70.pdb.gz	AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens OX=9606 GN=AZIN2 PE=1 SV=1
7	AFDB:Q8BVM4	0.843	0.823	3.506E-52	459	0.420	0.410	Q8BVM4.pdb.gz	AZIN2_MOUSE Antizyme inhibitor 2 OS=Mus musculus OX=10090 GN=Azin2 PE=1 SV=1
8	AFDB:P07805	0.829	0.876	6.686E-52	423	0.413	0.437	P07805.pdb.gz	DCOR_TRYBB Ornithine decarboxylase OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=2
9	AFDB:P41931	0.836	0.886	1.321E-45	422	0.324	0.344	P41931.pdb.gz	DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans OX=6239 GN=odc-1 PE=1 SV=2
10	PDB:1f3tB	0.759	0.887	1.739E-45	381	0.402	0.472	1f3tB.pdb.gz	Altering the reaction specificity of eukaryotic ornithine decarboxylase.
11	AFDB:M4TB00	0.825	0.870	4.216E-44	424	0.326	0.344	M4TB00.pdb.gz	M4TB00_TELCI Ornithine decarboxylase (Fragment) OS=Teladorsagia circumcincta OX=45464 PE=2 SV=1
12	AFDB:Q54UF3	0.831	0.808	7.150E-44	461	0.328	0.319	Q54UF3.pdb.gz	DCOR_DICDI Probable ornithine decarboxylase OS=Dictyostelium discoideum OX=44689 GN=odc PE=3 SV=1
13	AFDB:D4A693	0.824	0.808	1.724E-43	457	0.342	0.335	D4A693.pdb.gz	AZIN2_RAT Antizyme inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Azin2 PE=1 SV=2
14	PDB:4aibA	0.670	0.874	6.065E-29	339	0.230	0.304	4aibA.pdb.gz
15	PDB:1hkvA	0.675	0.678	1.917E-22	446	0.161	0.161	1hkvA.pdb.gz	Crystal Structure of Mycobacterium Tuberculosis Diaminopimelate Decarboxylase, an Essential Enzyme in Bacterial Lysine Biosynthesis
16	PDB:7ru7A	0.669	0.722	9.350E-22	412	0.170	0.184	7ru7A.pdb.gz	Crystal structure of BtrK, a decarboxylase involved in the (S)-4-amino-2-hydroxybutyrate (AHBA) formation during butirosin biosynthesis
17	PDB:1knwA	0.654	0.692	7.293E-21	421	0.141	0.150	1knwA.pdb.gz	Diaminopimelate Decarboxylase uses a Versatile Active Site for Stereospecific Decarboxylation
18	PDB:3n29A	0.593	0.701	4.128E-18	371	0.150	0.181	3n29A.pdb.gz	Evolution of substrate specificity within a diverse family of beta/alpha-barrel-fold basic amino acid decarboxylases: X-ray structure determination of enzymes with specificity for L-arginine and carboxynorspermidine.
19	PDB:3nzqA	0.653	0.486	1.378E-15	628	0.165	0.118	3nzqA.pdb.gz	Structures of bacterial biosynthetic arginine decarboxylases.
20	PDB:1rcqA	0.487	0.588	7.939E-10	357	0.112	0.140	1rcqA.pdb.gz	Crystal structure at 1.45 A resolution of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14977	0.0	928	448	1.000	1.000	AZIN1_HUMAN Antizyme inhibitor 1 OS=Homo sapiens OX=9606 GN=AZIN1 PE=1 SV=2
2	O35484	0.0	895	448	0.958	0.958	AZIN1_MOUSE Antizyme inhibitor 1 OS=Mus musculus OX=10090 GN=Azin1 PE=1 SV=1
3	Q63764	0.0	877	448	0.931	0.931	AZIN1_RAT Antizyme inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Azin1 PE=1 SV=1
4	P11926	7.35e-158	456	461	0.498	0.484	DCOR_HUMAN Ornithine decarboxylase OS=Homo sapiens OX=9606 GN=ODC1 PE=1 SV=2
5	P00860	7.01e-157	454	461	0.498	0.484	DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus OX=10090 GN=Odc1 PE=1 SV=2
6	P09057	2.18e-156	452	461	0.511	0.497	DCOR_RAT Ornithine decarboxylase OS=Rattus norvegicus OX=10116 GN=Odc1 PE=1 SV=1
7	Q9DGJ4	3.14e-152	442	461	0.473	0.460	Q9DGJ4_DANRE Odc1 protein OS=Danio rerio OX=7955 GN=wu:fc54f04 PE=2 SV=1
8	Q96A70	2.18e-129	384	460	0.429	0.417	AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens OX=9606 GN=AZIN2 PE=1 SV=1
9	Q8BVM4	2.00e-128	381	459	0.422	0.412	AZIN2_MOUSE Antizyme inhibitor 2 OS=Mus musculus OX=10090 GN=Azin2 PE=1 SV=1
10	P07805	3.76e-125	371	423	0.411	0.435	DCOR_TRYBB Ornithine decarboxylase OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=2
11	D4A693	7.33e-97	300	457	0.362	0.354	AZIN2_RAT Antizyme inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Azin2 PE=1 SV=2
12	Q9UQW9	1.04e-92	288	432	0.335	0.347	DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spe1 PE=2 SV=1
13	M4TB00	3.30e-90	282	424	0.328	0.347	M4TB00_TELCI Ornithine decarboxylase (Fragment) OS=Teladorsagia circumcincta OX=45464 PE=2 SV=1
14	Q54UF3	3.20e-88	278	461	0.324	0.315	DCOR_DICDI Probable ornithine decarboxylase OS=Dictyostelium discoideum OX=44689 GN=odc PE=3 SV=1
15	P41931	3.95e-85	269	422	0.317	0.336	DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans OX=6239 GN=odc-1 PE=1 SV=2
16	P78599	1.55e-74	243	473	0.333	0.315	DCOR_CANAL Ornithine decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPE1 PE=3 SV=2
17	P93351	2.32e-74	241	433	0.310	0.321	ODC1B_TOBAC Ornithine decarboxylase 1B, chloroplastic OS=Nicotiana tabacum OX=4097 GN=ODC1B PE=2 SV=1
18	E0WN94	3.34e-74	241	433	0.308	0.319	ODC_NICGL Ornithine decarboxylase, chloroplastic OS=Nicotiana glauca OX=4090 GN=ODC PE=2 SV=1
19	A0A1S4AUX8	5.66e-74	240	432	0.308	0.319	ODC1A_TOBAC Ornithine decarboxylase 1A, chloroplastic OS=Nicotiana tabacum OX=4097 GN=ODC1A PE=2 SV=1
20	Q9FPK5	7.97e-72	234	432	0.301	0.312	ODC_NICGU Ornithine decarboxylase, chloroplastic OS=Nicotiana glutinosa OX=35889 GN=ODC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02784 Orn_Arg_deC_N	1.6e-80	281.6	Pyridoxal-dependent decarboxylase, pyridoxal binding domain
2	PF00278 Orn_DAP_Arg_deC	2.1e-17	74.4	Pyridoxal-dependent decarboxylase, C-terminal sheet domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000473381	0.998	Ornithine decarboxylase antizyme 1
2	9606.ENSP00000313922	0.987	Ornithine decarboxylase antizyme 3
3	9606.ENSP00000463013	0.974	Ornithine decarboxylase antizyme 2
4	9606.ENSP00000357880	0.774	S-adenosylmethionine decarboxylase proenzyme
5	9606.ENSP00000238738	0.753	Rho-related GTP-binding protein RhoQ
6	9606.ENSP00000359337	0.703	Gamma-aminobutyric acid receptor subunit alpha-3
7	9606.ENSP00000414982	0.687	Kinesin light chain 1
8	9606.ENSP00000357459	0.686	Double-stranded RNA-specific adenosine deaminase
9	9606.ENSP00000385746	0.684	Spermine synthase
10	9606.ENSP00000399403	0.681	Kinesin light chain 2
11	9606.ENSP00000393379	0.643	Kinesin heavy chain isoform 5C
12	9606.ENSP00000234111	0.636	Ornithine decarboxylase
13	9606.ENSP00000397172	0.627	Bladder cancer-associated protein
14	9606.ENSP00000285928	0.625	Leucine-rich repeat and guanylate kinase domain-containing protein
15	9606.ENSP00000366156	0.624	Spermidine synthase
16	9606.ENSP00000364037	0.620	Testis-expressed protein 10
17	9606.ENSP00000259746	0.612	CSC1-like protein 2
18	9606.ENSP00000293760	0.607	LEM domain-containing protein 2
19	9606.ENSP00000428056	0.605	Phosphatidylinositol 3-kinase regulatory subunit alpha
20	9606.ENSP00000258654	0.603	Conserved oligomeric Golgi complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008047	1.000	enzyme activator activity
GO:0016831	0.998	carboxy-lyase activity
GO:0005515	0.996	protein binding
GO:0004586	0.904	ornithine decarboxylase activity
GO:0042979	0.611	ornithine decarboxylase regulator activity
GO:0042978	0.507	ornithine decarboxylase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.991	regulation of biological process
GO:0048518	0.967	positive regulation of biological process
GO:0050794	0.935	regulation of cellular process
GO:0008152	0.818	metabolic process
GO:0071704	0.736	organic substance metabolic process
GO:0048522	0.722	positive regulation of cellular process
GO:0006807	0.699	nitrogen compound metabolic process
GO:1901564	0.642	organonitrogen compound metabolic process
GO:0009987	0.545	cellular process
GO:0034762	0.443	regulation of transmembrane transport
GO:0019222	0.381	regulation of metabolic process
GO:0080090	0.322	regulation of primary metabolic process
GO:0051171	0.322	regulation of nitrogen compound metabolic process
GO:0060255	0.321	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005737	0.975	cytoplasm
GO:0005829	0.965	cytosol
GO:0005634	0.955	nucleus
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0031974	0.382	membrane-enclosed lumen
GO:0031981	0.370	nuclear lumen
GO:0005654	0.330	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	0.998	Carboxy-lyases.
RHEA:22964	0.904	H(+) + L-ornithine = CO2 + putrescine
EC:4.1.1.17	0.904	ornithine decarboxylase.

[back to server]