StarFunc result for job id O14980

User Input

>input (1071 residues)
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RNP8	0.992	0.983	0.000	1081	0.962	0.953	A0A2R8RNP8.pdb.gz
2	PDB:3gjxA	0.954	0.981	5.481E-101	1041	0.950	0.977	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
3	AFDB:Q9TVM2	0.979	0.986	1.228E-93	1063	0.705	0.710	Q9TVM2.pdb.gz	XPO1_DROME Exportin-1 OS=Drosophila melanogaster OX=7227 GN=emb PE=1 SV=1
4	PDB:3gb8A	0.825	0.919	1.291E-85	958	0.891	0.996	3gb8A.pdb.gz
5	AFDB:P14068	0.880	0.875	1.514E-75	1078	0.540	0.536	P14068.pdb.gz	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
6	AFDB:C8VRM0	0.885	0.884	1.325E-73	1072	0.530	0.530	C8VRM0.pdb.gz	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
7	PDB:4bsmA	0.681	0.798	5.823E-72	896	0.822	0.982	4bsmA.pdb.gz
8	AFDB:Q9SMV6	0.896	0.893	4.926E-70	1075	0.490	0.488	Q9SMV6.pdb.gz	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
9	AFDB:P30822	0.901	0.891	5.850E-70	1084	0.471	0.465	P30822.pdb.gz	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
10	AFDB:F4IZR5	0.897	0.893	1.431E-69	1076	0.489	0.487	F4IZR5.pdb.gz	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
11	AFDB:A0A1D8PRR9	0.886	0.879	4.016E-69	1079	0.466	0.462	A0A1D8PRR9.pdb.gz	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
12	PDB:3wyfC	0.908	0.934	1.486E-67	1040	0.465	0.479	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
13	PDB:5uwuC	0.885	0.948	1.965E-65	998	0.449	0.482	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
14	AFDB:Q382A3	0.865	0.896	2.249E-50	1033	0.315	0.326	Q382A3.pdb.gz	Q382A3_TRYB2 Exportin 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5940 PE=3 SV=1
15	PDB:2xwuB	0.518	0.589	2.094E-18	910	0.142	0.167	2xwuB.pdb.gz
16	AFDB:F1Q9F5	0.670	0.743	1.055E-17	953	0.147	0.165	F1Q9F5.pdb.gz	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
17	PDB:4c0qA	0.637	0.765	9.230E-16	871	0.130	0.160	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
18	PDB:6gx9A	0.636	0.732	2.681E-15	912	0.137	0.161	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
19	PDB:3icqT	0.524	0.581	2.262E-14	949	0.140	0.158	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
20	PDB:5yu7A	0.635	0.613	2.346E-13	1118	0.164	0.157	5yu7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PRR9	0.0	1012	1079	0.470	0.466	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
2	C8VRM0	0.0	1179	1072	0.538	0.537	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
3	E7F0E8	0.0	2083	1071	0.927	0.927	E7F0E8_DANRE Exportin 1 (CRM1 homolog, yeast) a OS=Danio rerio OX=7955 GN=xpo1a PE=1 SV=2
4	F4IZR5	0.0	1069	1076	0.495	0.493	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
5	O14980	0.0	2230	1071	1.000	1.000	XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1
6	P14068	0.0	1199	1078	0.543	0.540	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
7	P30822	0.0	1031	1084	0.474	0.469	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
8	Q5ZIV8	0.0	613	300	0.275	0.980	Q5ZIV8_CHICK Importin N-terminal domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_23d16 PE=2 SV=1
9	Q6P5F9	0.0	2187	1071	0.980	0.980	XPO1_MOUSE Exportin-1 OS=Mus musculus OX=10090 GN=Xpo1 PE=1 SV=1
10	Q80U96	0.0	2183	1071	0.979	0.979	XPO1_RAT Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 PE=1 SV=1
11	Q9PW90	0.0	2161	1071	0.968	0.968	Q9PW90_XENLA CRM1/XPO1 protein OS=Xenopus laevis OX=8355 PE=2 SV=1
12	Q9SMV6	0.0	1065	1075	0.495	0.493	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
13	Q9TVM2	0.0	1557	1063	0.706	0.711	XPO1_DROME Exportin-1 OS=Drosophila melanogaster OX=7227 GN=emb PE=1 SV=1
14	Q382A3	4.48e-178	550	1033	0.317	0.328	Q382A3_TRYB2 Exportin 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5940 PE=3 SV=1
15	Q7Z2C1	5.03e-177	547	1033	0.316	0.327	Q7Z2C1_TRYBB Exportin 1 OS=Trypanosoma brucei brucei OX=5702 GN=XPO1 PE=3 SV=1
16	Q9HAV4	1.03e-10	68.6	1204	0.047	0.042	XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1
17	Q924C1	5.20e-10	66.2	1204	0.051	0.046	XPO5_MOUSE Exportin-5 OS=Mus musculus OX=10090 GN=Xpo5 PE=1 SV=1
18	F1Q9F5	7.16e-10	65.9	953	0.104	0.116	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
19	Q9JM04	9.36e-08	58.9	963	0.111	0.124	IPO13_RAT Importin-13 OS=Rattus norvegicus OX=10116 GN=Ipo13 PE=2 SV=1
20	O94829	3.74e-07	57.0	963	0.110	0.123	IPO13_HUMAN Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18220 BspA_v	1.6e+02	13.5	Adhesin BspA variable domain
2	PF08767 CRM1_C	2e-130	446.3	CRM1 C terminal
3	PF18777 CRM1_repeat	8.8e-15	65.3	Chromosome region maintenance or exportin repeat
4	PF18784 CRM1_repeat_2	6.8e-31	117.1	CRM1 / Exportin repeat 2
5	PF18787 CRM1_repeat_3	2.4e-27	106.0	CRM1 / Exportin repeat 3
6	PF08282 Hydrolase_3	79	14.4	haloacid dehalogenase-like hydrolase
7	PF03810 IBN_N	5.7e-09	47.1	Importin-beta N-terminal domain
8	PF08389 Xpo1	7.8e-39	144.5	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375659.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353289.1	0.998	RAN, member RAS oncogene family
2	61622.XP_010359259.1	0.998	Nucleoporin 214
3	61622.XP_010365027.1	0.985	Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit
4	61622.XP_010380196.1	0.983	Functions as an U snRNP-specific nuclear import adapter. Involved in the trimethylguanosine (m3G)-cap-dependent nuclear import of U snRNPs. Binds specifically to the terminal m3G-cap U snRNAs.
5	61622.XP_010365236.1	0.982	Nucleoporin 98
6	61622.XP_010367070.1	0.982	RAN binding protein 2
7	61622.XP_010374892.1	0.976	Ran GTPase-activating protein 1 isoform X1
8	61622.XP_010386739.1	0.975	Ran-specific GTPase-activating protein
9	61622.XP_010360689.1	0.953	Acts as a tumor suppressor in many tumor types
10	61622.XP_010369310.1	0.948	Cyclin dependent kinase inhibitor 1B
11	61622.XP_010365489.1	0.947	Ran-binding protein 3 isoform X1
12	61622.XP_010383162.1	0.947	Nuclear RNA export factor 1
13	61622.XP_010378644.1	0.940	Regulator of chromosome condensation isoform X1
14	61622.XP_010366070.1	0.935	Belongs to the PKI family
15	61622.XP_010354149.1	0.934	Nucleoporin 88
16	61622.XP_010362072.1	0.926	Importin 4
17	61622.XP_010363990.1	0.921	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 4 Proteins
18	61622.XP_010377662.1	0.911	Karyopherin subunit beta 1
19	61622.XP_010367825.1	0.900	Nucleoporin 62
20	61622.XP_010376117.1	0.896	Proliferation-associated protein 2G4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005049	1.000	nuclear export signal receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.966	biological regulation
GO:0051168	0.962	nuclear export
GO:0080090	0.948	regulation of primary metabolic process
GO:0050794	0.943	regulation of cellular process
GO:0033036	0.895	macromolecule localization
GO:0071705	0.859	nitrogen compound transport
GO:0050896	0.852	response to stimulus
GO:0060255	0.842	regulation of macromolecule metabolic process
GO:0071702	0.839	organic substance transport
GO:0031323	0.830	regulation of cellular metabolic process
GO:0051171	0.824	regulation of nitrogen compound metabolic process
GO:0070727	0.823	cellular macromolecule localization
GO:0008104	0.807	protein localization
GO:0045184	0.782	establishment of protein localization
GO:0015031	0.765	protein transport
GO:0006611	0.745	protein export from nucleus
GO:0048518	0.519	positive regulation of biological process
GO:0071840	0.509	cellular component organization or biogenesis
GO:0044419	0.470	biological process involved in interspecies interaction between organisms
GO:0048522	0.460	positive regulation of cellular process
GO:0048519	0.455	negative regulation of biological process
GO:0009605	0.387	response to external stimulus
GO:0048523	0.382	negative regulation of cellular process
GO:0019219	0.379	regulation of nucleobase-containing compound metabolic process
GO:0009607	0.365	response to biotic stimulus
GO:0008152	0.362	metabolic process
GO:0009893	0.347	positive regulation of metabolic process
GO:0010468	0.339	regulation of gene expression
GO:0071704	0.329	organic substance metabolic process
GO:0051246	0.328	regulation of protein metabolic process
GO:0051252	0.318	regulation of RNA metabolic process
GO:0010556	0.317	regulation of macromolecule biosynthetic process
GO:0031326	0.310	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.982	cytoplasm
GO:0070013	0.975	intracellular organelle lumen
GO:0031981	0.974	nuclear lumen
GO:0032991	0.903	protein-containing complex
GO:0012505	0.633	endomembrane system
GO:0016020	0.482	membrane
GO:0005829	0.423	cytosol
GO:0043232	0.416	intracellular non-membrane-bounded organelle
GO:0005654	0.336	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]