StarFunc result for job id O14981

User Input

>input (1849 residues)
MAVSRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRI
AAGQAVEAIVKNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLG
SAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTS
ASFVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDG
EPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNEWPLESFCEELCNDLFNPSWE
VRHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVS
DEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR
QDVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPFIINTLWDAL
LELDDLTASTNSIMTLLSSLLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVRRAALET
LFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVV
AAACPWMGAWLCLMMQPSHLPIDLNMLLEVKARAKEKTGGKVRQGQSQNKEVLQEYIAGA
DTIMEDPATRDFVVMRARMMAAKLLGALCCCICDPGVNVVTQEIKPAESLGQLLLFHLNS
KSALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQ
LISSLADVHIEVGNRVNNNVLTIDQASDLVTTVFNEATSSFDLNPQVLQQLDSKRQQVQM
TVTETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQNYAAQC
IAKLLQQCTTRTPCPNSKIIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSTSEKDGM
HHTVTKHRGIITLYRHQKAAFAITSRRGPTPKAVKAQIADLPAGSSGNILVELDEAQKPY
LVQRRGAEFALTTIVKHFGGEMAVKLPHLWDAMVGPLRNTIDINNFDGKSLLDKGDSPAQ
ELVNSLQVFETAAASMDSELHPLLVQHLPHLYMCLQYPSTAVRHMAARCVGVMSKIATME
TMNIFLEKVLPWLGAIDDSVKQEGAIEALACVMEQLDVGIVPYIVLLVVPVLGRMSDQTD
SVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPV
PINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSK
LAECMPLPSLVVCPPTLTGHWVDEVGKFCSREYLNPLHYTGPPTERIRLQHQVKRHNLIV
ASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNV
LELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFL
LRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLSEETEKP
KLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALK
QLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGS
IPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRA
HRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTL
DKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5BT18	0.840	0.762	0.000	2045	0.421	0.380	B5BT18.pdb.gz	BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana OX=3702 GN=BTAF1 PE=1 SV=1
2	AFDB:O14981	1.000	1.000	0.000	1849	1.000	1.000	O14981.pdb.gz	BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2
3	AFDB:O43065	0.828	0.786	0.000	1953	0.392	0.371	O43065.pdb.gz	BTAF1_SCHPO TATA-binding protein-associated factor mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mot1 PE=1 SV=4
4	AFDB:P32333	0.715	0.710	0.000	1867	0.375	0.371	P32333.pdb.gz	BTAF1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT1 PE=1 SV=1
5	AFDB:Q54M42	0.848	0.784	0.000	2005	0.422	0.390	Q54M42.pdb.gz	Q54M42_DICDI SNF2-related domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286219 PE=4 SV=1
6	AFDB:Q9VF02	0.749	0.723	0.000	1923	0.471	0.452	Q9VF02.pdb.gz	Q9VF02_DROME Helicase 89B, isoform B OS=Drosophila melanogaster OX=7227 GN=Hel89B PE=1 SV=3
7	AFDB:Q8SVZ5	0.492	0.692	6.783E-49	1256	0.196	0.289	Q8SVZ5.pdb.gz	Q8SVZ5_ENCCU Similarity to HELICASE MOT1 OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=ECU03_1530 PE=1 SV=1
8	AFDB:Q9VDY1	0.247	0.277	2.020E-28	1638	0.114	0.129	Q9VDY1.pdb.gz	INO80_DROME Chromatin-remodeling ATPase INO80 OS=Drosophila melanogaster OX=7227 GN=Ino80 PE=1 SV=2
9	AFDB:A0A1D8PJG4	0.246	0.342	3.384E-28	1302	0.131	0.186	A0A1D8PJG4.pdb.gz	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
10	AFDB:P38144	0.262	0.413	1.478E-27	1129	0.110	0.180	P38144.pdb.gz	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
11	PDB:7oo3b	0.237	0.755	5.251E-27	534	0.108	0.373	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:6jylK	0.229	0.793	6.328E-25	504	0.102	0.373	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
13	PDB:6tdaS	0.230	0.522	1.716E-22	783	0.112	0.266	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
14	PDB:5vvrM	0.214	0.707	7.366E-21	503	0.098	0.362	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
15	PDB:6g0lM	0.209	0.438	7.930E-21	855	0.085	0.185	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
16	PDB:6gejM	0.213	0.552	7.930E-21	688	0.097	0.262	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7epuB	0.161	0.323	3.594E-20	748	0.091	0.226	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
18	PDB:6g0lW	0.218	0.443	6.482E-20	878	0.092	0.195	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
19	PDB:6uxwA	0.230	0.525	7.512E-20	778	0.112	0.266	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
20	PDB:6kw3Y	0.229	0.720	1.570E-19	548	0.097	0.327	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5BT18	0.0	1133	2045	0.362	0.327	BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana OX=3702 GN=BTAF1 PE=1 SV=1
2	O14981	0.0	3832	1849	1.000	1.000	BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2
3	O43065	0.0	971	1953	0.270	0.256	BTAF1_SCHPO TATA-binding protein-associated factor mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mot1 PE=1 SV=4
4	P32333	0.0	1175	1867	0.391	0.387	BTAF1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT1 PE=1 SV=1
5	Q2M1V9	0.0	3832	1849	1.000	1.000	Q2M1V9_HUMAN BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=1
6	Q54M42	0.0	927	2005	0.237	0.218	Q54M42_DICDI SNF2-related domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286219 PE=4 SV=1
7	Q9VF02	0.0	1602	1923	0.485	0.466	Q9VF02_DROME Helicase 89B, isoform B OS=Drosophila melanogaster OX=7227 GN=Hel89B PE=1 SV=3
8	Q8SVZ5	1.35e-110	386	1256	0.130	0.191	Q8SVZ5_ENCCU Similarity to HELICASE MOT1 OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=ECU03_1530 PE=1 SV=1
9	Q9UR24	1.02e-84	303	973	0.112	0.213	RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp26 PE=4 SV=1
10	F8VPZ5	3.10e-82	302	1481	0.108	0.135	ERCC6_MOUSE DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1
11	Q03468	3.31e-82	302	1493	0.109	0.135	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
12	A0A0G2JTU1	7.65e-82	300	1474	0.107	0.134	A0A0G2JTU1_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
13	Q57UN8	2.17e-78	286	1126	0.105	0.172	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
14	A0A0P0WGX7	1.97e-76	278	987	0.105	0.198	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
15	Q8W103	1.11e-75	277	1090	0.109	0.185	CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana OX=3702 GN=CHR24 PE=2 SV=1
16	P40352	1.82e-75	276	1085	0.107	0.182	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
17	Q9ZV43	2.86e-75	277	1187	0.104	0.162	CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana OX=3702 GN=CHR8 PE=2 SV=1
18	P41877	1.90e-73	269	1009	0.097	0.177	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
19	P38144	2.84e-73	270	1129	0.099	0.162	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
20	Q08773	9.83e-73	269	1120	0.101	0.167	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	0.014	27.0	non-SMC mitotic condensation complex subunit 1
2	PF12054 DUF3535	3.7e-127	436.9	Domain of unknown function (DUF3535)
3	PF20416 DUF6700	0.3	22.0	Domain of unknown function (DUF6700)
4	PF02985 HEAT	2e-16	69.7	HEAT repeat
5	PF13646 HEAT_2	0.0001	33.9	HEAT repeats
6	PF13513 HEAT_EZ	0.29	23.0	HEAT-like repeat
7	PF00271 Helicase_C	8.4e-14	63.2	Helicase conserved C-terminal domain
8	PF09632 Rac1	33	15.1	Rac1-binding domain
9	PF00176 SNF2-rel_dom	2e-54	196.3	SNF2-related domain
10	PF07571 TAF6_C	1.5	20.4	TAF6 C-terminal HEAT repeat domain
11	PF08064 UME	8.6e+02	11.3	UME (NUC010) domain
12	PF12755 Vac14_Fab1_bd	3.1e-08	45.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375942	0.999	TATA-box-binding protein
2	9606.ENSP00000367406	0.946	Transcription initiation factor TFIID subunit 2
3	9606.ENSP00000307850	0.936	Dr1-associated corepressor
4	9606.ENSP00000359295	0.922	Protein Dr1
5	9606.ENSP00000247219	0.918	TATA box-binding protein-like protein 2
6	9606.ENSP00000237264	0.892	TATA box-binding protein-like protein 1
7	9606.ENSP00000351575	0.884	Transcription factor TFIIIB component B'' homolog
8	9606.ENSP00000359531	0.860	Transcription initiation factor IIB
9	9606.ENSP00000238789	0.829	ATPase family, AAA domain containing 2B
10	9606.ENSP00000387361	0.825	Strawberry notch homolog 1
11	9606.ENSP00000219548	0.801	E3 ubiquitin-protein ligase CHIP
12	9606.ENSP00000309096	0.791	Beta-1,4-glucuronyltransferase 1
13	9606.ENSP00000267425	0.788	Nucleolar protein 9
14	9606.ENSP00000359848	0.788	GPI-anchor transamidase
15	9606.ENSP00000423550	0.783	Involved in repair of DNA damage following UV irradiation, acting either in the absence of ERCC6 or synergistically with ERCC6. Involved in the regulation of gene expression. In the absence of ERCC6, induces the expression of genes characteristic of interferon-like antiviral responses. This response is almost completely suppressed in the presence of ERCC6. In the presence of ERCC6, regulates the expression of genes involved in metabolism regulation, including IGFBP5 and IGFBP7. In vitro binds to PGBD3-related transposable elements, called MER85s
16	9606.ENSP00000418379	0.782	Transcription initiation factor TFIID subunit 1-like
17	9606.ENSP00000406549	0.764	Transcription initiation factor TFIID subunit 1
18	9606.ENSP00000354916	0.763	Dual specificity protein phosphatase CDC14A
19	9606.ENSP00000426503	0.751	E3 ubiquitin-protein ligase RNF4
20	9606.ENSP00000364389	0.741	Dual specificity protein phosphatase CDC14B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	0.998	ATP-dependent activity, acting on DNA
GO:0003712	0.997	transcription coregulator activity
GO:0097159	0.770	organic cyclic compound binding
GO:1901363	0.769	heterocyclic compound binding
GO:0003676	0.729	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0048519	0.994	negative regulation of biological process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048523	0.980	negative regulation of cellular process
GO:0010605	0.970	negative regulation of macromolecule metabolic process
GO:0045934	0.937	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.865	negative regulation of RNA metabolic process
GO:0045892	0.823	negative regulation of DNA-templated transcription
GO:0051098	0.815	regulation of binding
GO:0071704	0.694	organic substance metabolic process
GO:0009987	0.670	cellular process
GO:0051100	0.646	negative regulation of binding
GO:0043170	0.642	macromolecule metabolic process
GO:0044237	0.541	cellular metabolic process
GO:0048518	0.506	positive regulation of biological process
GO:0044238	0.500	primary metabolic process
GO:0006807	0.491	nitrogen compound metabolic process
GO:0009893	0.379	positive regulation of metabolic process
GO:0048522	0.370	positive regulation of cellular process
GO:0010604	0.368	positive regulation of macromolecule metabolic process
GO:0031325	0.360	positive regulation of cellular metabolic process
GO:0051173	0.357	positive regulation of nitrogen compound metabolic process
GO:0006357	0.346	regulation of transcription by RNA polymerase II
GO:0045935	0.335	positive regulation of nucleobase-containing compound metabolic process
GO:0090304	0.318	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]