StarFunc result for job id O14983

User Input

>input (1001 residues)
MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGML
DPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDD
LPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLR
ALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5zmwA	0.722	0.722	0.000	1000	0.957	0.958	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
2	PDB:7e7sA	0.712	0.700	0.000	1020	0.835	0.820	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
3	AFDB:A0A0R4IQS8	0.986	0.949	0.000	1041	0.828	0.796	A0A0R4IQS8.pdb.gz	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
4	AFDB:A9C3Q4	0.990	0.951	0.000	1042	0.834	0.801	A9C3Q4.pdb.gz
5	AFDB:G5EEK8	0.944	0.894	0.000	1059	0.719	0.680	G5EEK8.pdb.gz	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
6	AFDB:O14983	1.000	1.000	0.000	1001	1.000	1.000	O14983.pdb.gz	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
7	AFDB:O55143	0.984	0.944	0.000	1044	0.840	0.806	O55143.pdb.gz	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	AFDB:P18596	0.990	0.992	0.000	999	0.754	0.756	P18596.pdb.gz	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
9	AFDB:P22700	0.985	0.967	0.000	1020	0.711	0.698	P22700.pdb.gz	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
10	AFDB:Q5U3A4	0.995	0.991	0.000	1005	0.851	0.848	Q5U3A4.pdb.gz
11	AFDB:Q9SY55	0.929	0.932	5.428E-104	998	0.546	0.548	Q9SY55.pdb.gz	ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA3 PE=1 SV=3
12	AFDB:Q9UUY0	0.871	0.875	7.935E-102	997	0.536	0.539	Q9UUY0.pdb.gz	Q9UUY0_NEUCS Putative calcium P-type ATPase (Fragment) OS=Neurospora crassa OX=5141 GN=nca-1 PE=4 SV=1
13	PDB:8d3xA	0.823	0.833	1.779E-54	989	0.279	0.282	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
14	PDB:7x20A	0.830	0.842	4.404E-54	986	0.274	0.278	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
15	PDB:3ixzA	0.822	0.824	1.139E-53	998	0.284	0.285	3ixzA.pdb.gz
16	PDB:3b8eA	0.806	0.808	2.902E-52	998	0.280	0.281	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
17	PDB:6a69A	0.587	0.636	1.498E-42	911	0.259	0.284	6a69A.pdb.gz
18	PDB:7vpkA	0.723	0.689	2.211E-36	1055	0.192	0.182	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.479	0.576	1.588E-34	804	0.204	0.254	7vh5A.pdb.gz
20	PDB:7m5xA	0.689	0.690	1.157E-33	1000	0.184	0.184	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQS8	1669	1041	0.831	0.799	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
2	A8WI68	1272	932	0.627	0.674	A8WI68_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
3	B6CAM1	1989	994	0.959	0.966	B6CAM1_RABIT Calcium-transporting ATPase OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
4	G5EEK8	1446	1059	0.719	0.680	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
5	O14983	2059	1001	1.000	1.000	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
6	O23087	878	1054	0.516	0.491	ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA2 PE=1 SV=1
7	O55143	1706	1044	0.841	0.807	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	P04191	2006	1001	0.967	0.967	AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus OX=9986 GN=ATP2A1 PE=1 SV=1
9	P11507	1702	1043	0.838	0.804	AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2a2 PE=1 SV=1
10	P11607	1702	1042	0.840	0.807	AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa OX=9823 GN=ATP2A2 PE=1 SV=1
11	P16615	1700	1042	0.837	0.804	AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1
12	P18596	1547	999	0.753	0.755	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
13	P22700	1435	1020	0.710	0.697	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
14	P92939	900	1061	0.523	0.494	ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA1 PE=1 SV=2
15	Q03669	1706	1041	0.842	0.810	AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus OX=9031 GN=ATP2A2 PE=2 SV=2
16	Q57Z55	851	1011	0.500	0.495	Q57Z55_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.570 PE=3 SV=1
17	Q642Z0	1736	994	0.852	0.858	Q642Z0_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=cb279 PE=1 SV=1
18	Q64518	1556	999	0.755	0.757	AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus OX=10090 GN=Atp2a3 PE=1 SV=4
19	Q64578	1991	994	0.961	0.968	AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2a1 PE=1 SV=1
20	Q6ZM60	1651	1035	0.825	0.798	Q6ZM60_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	2.6e-15	67.6	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	8.9e-42	154.4	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	1.4e-16	71.2	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	6.3e-51	184.0	E1-E2 ATPase
5	PF12710 HAD	34	16.4	haloacid dehalogenase-like hydrolase
6	PF00702 Hydrolase	5.2e-15	67.8	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.016	26.5	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349595

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350132	0.983	Cardiac phospholamban
2	9606.ENSP00000435380	0.977	Sarcolipin
3	9606.ENSP00000352608	0.928	Ryanodine receptor 1
4	9606.ENSP00000263388	0.911	Neurogenic locus notch homolog protein 3
5	9606.ENSP00000277541	0.910	Neurogenic locus notch homolog protein 1
6	9606.ENSP00000256646	0.908	Neurogenic locus notch homolog protein 2
7	9606.ENSP00000364163	0.902	Neurogenic locus notch homolog protein 4
8	9606.ENSP00000361636	0.892	Troponin C, skeletal muscle
9	9606.ENSP00000252825	0.890	Sarcoplasmic reticulum histidine-rich calcium-binding protein
10	9606.ENSP00000371331	0.887	Troponin I, fast skeletal muscle
11	9606.ENSP00000382518	0.873	Sarcalumenin
12	9606.ENSP00000278317	0.868	Troponin T, fast skeletal muscle
13	9606.ENSP00000352272	0.865	Myozenin-1
14	9606.ENSP00000226207	0.827	Myosin-1
15	9606.ENSP00000440045	0.822	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
16	9606.ENSP00000357057	0.813	Calsequestrin-1
17	9606.ENSP00000340330	0.811	Histone acetyltransferase KAT5
18	9606.ENSP00000325239	0.806	Myosin light chain, phosphorylatable, fast skeletal muscle
19	9606.ENSP00000353072	0.805	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
20	9606.ENSP00000261523	0.800	Nuclear receptor ROR-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005388	0.998	P-type calcium transporter activity
GO:0043167	0.618	ion binding
GO:0097159	0.541	organic cyclic compound binding
GO:1901363	0.494	heterocyclic compound binding
GO:0043169	0.393	cation binding
GO:0046872	0.375	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0009987	0.969	cellular process
GO:0032501	0.967	multicellular organismal process
GO:0044057	0.967	regulation of system process
GO:0006811	0.942	monoatomic ion transport
GO:0050896	0.925	response to stimulus
GO:0090257	0.900	regulation of muscle system process
GO:0006812	0.897	monoatomic cation transport
GO:0030001	0.876	metal ion transport
GO:0003012	0.871	muscle system process
GO:0006937	0.863	regulation of muscle contraction
GO:0098771	0.845	inorganic ion homeostasis
GO:0030003	0.812	intracellular monoatomic cation homeostasis
GO:0050794	0.806	regulation of cellular process
GO:0006816	0.786	calcium ion transport
GO:0055074	0.768	calcium ion homeostasis
GO:0006874	0.762	intracellular calcium ion homeostasis
GO:0032502	0.708	developmental process
GO:0048856	0.434	anatomical structure development
GO:0055085	0.411	transmembrane transport
GO:0048518	0.338	positive regulation of biological process
GO:0048519	0.327	negative regulation of biological process
GO:0051716	0.317	cellular response to stimulus
GO:0034220	0.311	monoatomic ion transmembrane transport
GO:0008016	0.309	regulation of heart contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005783	0.997	endoplasmic reticulum
GO:0016529	0.987	sarcoplasmic reticulum
GO:0098588	0.965	bounding membrane of organelle
GO:0005789	0.944	endoplasmic reticulum membrane
GO:0033017	0.701	sarcoplasmic reticulum membrane
GO:0071944	0.415	cell periphery
GO:0005886	0.408	plasma membrane
GO:0005634	0.361	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.998	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.998	P-type Ca(2+) transporter.

[back to server]