StarFunc result for job id O14986

User Input

>input (540 residues)
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14986	1.000	1.000	1.008E-98	540	1.000	1.000	O14986.pdb.gz	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
2	AFDB:A0A2R8QMJ9	0.736	0.673	1.613E-66	592	0.587	0.535	A0A2R8QMJ9.pdb.gz
3	AFDB:O60331	0.712	0.581	4.970E-66	668	0.626	0.506	O60331.pdb.gz	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
4	AFDB:Q99755	0.695	0.668	1.843E-61	562	0.570	0.548	Q99755.pdb.gz	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
5	AFDB:A0A0B4K7M0	0.676	0.489	6.057E-59	756	0.504	0.360	A0A0B4K7M0.pdb.gz	A0A0B4K7M0_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
6	AFDB:Q0E8Y1	0.662	0.463	2.097E-57	781	0.519	0.359	Q0E8Y1.pdb.gz	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
7	AFDB:Q9W2R3	0.631	0.435	8.559E-57	792	0.474	0.323	Q9W2R3.pdb.gz	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
8	AFDB:Q7JNK2	0.475	0.553	5.232E-40	462	0.354	0.413	Q7JNK2.pdb.gz	Q7JNK2_DROME Putative phosphatidyl-inositol-4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=4 SV=1
9	AFDB:P78356	0.546	0.700	4.283E-34	416	0.224	0.291	P78356.pdb.gz	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
10	AFDB:B3DJ34	0.543	0.715	6.350E-34	404	0.209	0.280	B3DJ34.pdb.gz	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
11	PDB:6ym4A	0.515	0.844	4.447E-27	322	0.183	0.307	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
12	PDB:1bo1A	0.503	0.812	9.775E-27	326	0.204	0.337	1bo1A.pdb.gz
13	PDB:7em5B	0.474	0.839	1.300E-25	297	0.198	0.360	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
14	PDB:7n81B	0.480	0.817	6.703E-23	307	0.180	0.316	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
15	PDB:2gk9B	0.420	0.881	6.496E-17	250	0.161	0.348	2gk9B.pdb.gz
16	PDB:2rsvA	0.180	0.224	2.005E-2	403	0.096	0.129	2rsvA.pdb.gz
17	PDB:6fadC	0.170	0.241	5.839E-2	359	0.030	0.045	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
18	PDB:2bujA	0.134	0.223	1.084E-1	291	0.028	0.052	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
19	PDB:4yc3A	0.146	0.231	1.147E-1	295	0.030	0.054	4yc3A.pdb.gz
20	PDB:2iewA	0.175	0.312	1.608E-1	258	0.072	0.151	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2VD51	0.0	590	584	0.559	0.517	A2VD51_DANRE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Danio rerio OX=7955 GN=zgc:158838 PE=1 SV=1
2	A6PW57	0.0	625	550	0.583	0.573	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
3	D3ZSI8	0.0	625	546	0.580	0.573	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
4	O14986	0.0	1120	540	1.000	1.000	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
5	O60331	0.0	644	668	0.600	0.485	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
6	O70161	0.0	654	661	0.624	0.510	PI51C_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Mus musculus OX=10090 GN=Pip5k1c PE=1 SV=2
7	P70181	0.0	1075	539	0.963	0.965	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1
8	P70182	0.0	630	546	0.581	0.575	PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2
9	Q503I3	0.0	598	559	0.574	0.555	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
10	Q5I6B8	0.0	650	688	0.607	0.477	PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus OX=10116 GN=Pip5k1c PE=1 SV=1
11	Q99755	0.0	625	562	0.583	0.560	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
12	Q9W1Y2	4.44e-178	521	729	0.478	0.354	Q9W1Y2_DROME FI05352p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=2
13	A0A0B4K7M0	9.68e-178	521	756	0.478	0.341	A0A0B4K7M0_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
14	Q8T0K5	9.34e-177	518	729	0.476	0.353	Q8T0K5_DROME GH26019p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=2 SV=1
15	Q9W1Y3	2.02e-175	515	750	0.465	0.335	Q9W1Y3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform E OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
16	A0A0B4K7E3	3.94e-175	515	777	0.465	0.323	A0A0B4K7E3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform F OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
17	Q0E8Y1	1.48e-174	514	781	0.465	0.321	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
18	O01759	2.86e-167	489	611	0.444	0.393	O01759_CAEEL PIPK domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ppk-1 PE=1 SV=2
19	Q9W2R3	6.93e-164	487	792	0.450	0.307	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
20	Q94544	1.25e-163	483	700	0.446	0.344	Q94544_DROME Phosphatidylinositol 4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	5.6e-88	306.3	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366563	0.968	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
2	9606.ENSP00000357869	0.964	Phosphatidylinositol 4-kinase beta
3	9606.ENSP00000255882	0.963	Phosphatidylinositol 4-kinase alpha
4	9606.ENSP00000373713	0.957	Phosphatidylinositide phosphatase SAC1
5	9606.ENSP00000289153	0.949	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
6	9606.ENSP00000430344	0.942	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
7	9606.ENSP00000359665	0.941	Phosphatidylinositol 4-kinase type 2-alpha
8	9606.ENSP00000367747	0.940	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
9	9606.ENSP00000352121	0.937	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
10	9606.ENSP00000345988	0.931	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
11	9606.ENSP00000360431	0.931	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
12	9606.ENSP00000388631	0.931	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
13	9606.ENSP00000367762	0.930	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
14	9606.ENSP00000479636	0.929	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
15	9606.ENSP00000266505	0.928	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
16	9606.ENSP00000348461	0.927	Ras-related C3 botulinum toxin substrate 1
17	9606.ENSP00000354519	0.927	Phosphatidylinositide phosphatase SAC2
18	9606.ENSP00000400175	0.927	Transforming protein RhoA
19	9606.ENSP00000263967	0.925	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
20	9606.ENSP00000264864	0.925	Phosphatidylinositol 4-kinase type 2-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016308	0.999	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0052742	0.842	phosphatidylinositol kinase activity
GO:0052813	0.377	phosphatidylinositol bisphosphate kinase activity
GO:0052812	0.333	phosphatidylinositol-3,4-bisphosphate 5-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006796	0.996	phosphate-containing compound metabolic process
GO:0046486	0.995	glycerolipid metabolic process
GO:0008610	0.993	lipid biosynthetic process
GO:0006650	0.993	glycerophospholipid metabolic process
GO:0046488	0.984	phosphatidylinositol metabolic process
GO:0090407	0.981	organophosphate biosynthetic process
GO:0046474	0.971	glycerophospholipid biosynthetic process
GO:0006661	0.957	phosphatidylinositol biosynthetic process
GO:0065007	0.937	biological regulation
GO:0050789	0.929	regulation of biological process
GO:0050794	0.899	regulation of cellular process
GO:0050896	0.352	response to stimulus
GO:0048583	0.336	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.962	organelle
GO:0016020	0.962	membrane
GO:0043227	0.907	membrane-bounded organelle
GO:0043229	0.858	intracellular organelle
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0042995	0.812	cell projection
GO:0120025	0.803	plasma membrane bounded cell projection
GO:0071944	0.768	cell periphery
GO:0005886	0.739	plasma membrane
GO:0098590	0.413	plasma membrane region
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	0.999	1-phosphatidylinositol-4-phosphate 5-kinase.
EC:2.7.1.153	0.333	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]