StarFunc result for job id O14990

User Input

>input (202 residues)
MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATY
RDYDLMKANEPGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSE
AYMRKILLHKQEKKRQFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEK
TAAEESEEAPLTGGLQTQSCDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14990	1.000	1.000	1.231E-28	202	1.000	1.000	O14990.pdb.gz	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
2	AFDB:P11845	0.399	0.394	2.837E-8	205	0.436	0.429	P11845.pdb.gz	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
3	AFDB:P42696	0.098	0.056	2.144E-1	430	0.139	0.065	P42696.pdb.gz	RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2
4	PDB:2o8aI	0.177	0.601	3.407E-1	59	0.134	0.458	2o8aI.pdb.gz
5	AFDB:A5D8S8	0.145	0.095	3.494E-1	319	0.158	0.100	A5D8S8.pdb.gz	HEXI1_DANRE Protein HEXIM1 OS=Danio rerio OX=7955 GN=hexim1 PE=2 SV=1
6	AFDB:Q4WQC6	0.192	0.090	8.656E-1	499	0.134	0.054	Q4WQC6.pdb.gz	Q4WQC6_ASPFU Myosin heavy chain OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12350 PE=4 SV=1
7	AFDB:Q8ILZ6	0.134	0.059	8.656E-1	667	0.158	0.048	Q8ILZ6.pdb.gz	Q8ILZ6_PLAF7 Phosphatidate cytidylyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1409900 PE=3 SV=1
8	AFDB:Q8RWQ4	0.173	0.053	9.281E-1	870	0.153	0.036	Q8RWQ4.pdb.gz	RGAP7_ARATH Rho GTPase-activating protein 7 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP7 PE=2 SV=1
9	AFDB:O74365	0.160	0.047	1.067	865	0.149	0.035	O74365.pdb.gz	SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sol1 PE=1 SV=1
10	AFDB:Q8IJS7	0.210	0.051	1.227	1139	0.144	0.025	Q8IJS7.pdb.gz	Q8IJS7_PLAF7 PRE-binding protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1011800 PE=4 SV=1
11	AFDB:Q6F2N0	0.194	0.101	1.865	437	0.129	0.059	Q6F2N0.pdb.gz	TGAL5_ORYSJ Transcription factor TGAL5 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14990	2.02e-150	417	202	1.000	1.000	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
2	P41236	4.90e-42	142	205	0.386	0.380	IPP2_HUMAN Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2
3	P50411	1.06e-41	141	205	0.401	0.395	IPP2_RAT Protein phosphatase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Ppp1r2 PE=1 SV=2
4	P11845	1.37e-41	141	205	0.391	0.385	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
5	Q6NXS1	2.75e-40	138	205	0.386	0.380	IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2
6	Q9DCL8	1.38e-39	136	206	0.391	0.383	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
7	Q9V3C7	0.002	40.0	205	0.238	0.234	Q9V3C7_DROME Inhibitor-2 OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
8	Q9N537	0.005	38.5	193	0.193	0.202	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
9	A8JNP7	0.007	38.9	310	0.238	0.155	A8JNP7_DROME Inhibitor-2, isoform B OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
10	Q9LM93	2.4	31.2	246	0.094	0.077	DPM1_ARATH Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
11	Q3EBF7	5.7	30.0	449	0.079	0.036	SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana OX=3702 GN=SLD2 PE=1 SV=1
12	P21192	8.8	29.6	770	0.104	0.027	ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACE2 PE=1 SV=1
13	Q86IF6	9.0	29.6	545	0.084	0.031	Q86IF6_DICDI Phox domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=vps5 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04979 IPP-2	7.5e-18	77.0	Protein phosphatase inhibitor 2 (IPP-2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815400.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003829788.1	0.832	Protein phosphatase 1 regulatory inhibitor subunit 11
2	9597.XP_008961475.1	0.664	Protein phosphatase 1 regulatory subunit 3D
3	9597.XP_003825405.1	0.631	Protein phosphatase 1 regulatory subunit 3C
4	9597.XP_003828854.1	0.573	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
5	9597.XP_003832521.1	0.573	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
6	9597.XP_008950752.1	0.573	Belongs to the PPP phosphatase family.
7	9597.XP_003824012.1	0.542	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
8	9597.XP_008968241.1	0.517	Protein phosphatase 1 regulatory subunit 3B
9	9597.XP_008966570.1	0.512	Calcium/calmodulin dependent serine protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.924	molecular function regulator activity
GO:0030234	0.788	enzyme regulator activity
GO:0019208	0.776	phosphatase regulator activity
GO:0019888	0.773	protein phosphatase regulator activity
GO:0140678	0.440	molecular function inhibitor activity
GO:0019212	0.382	phosphatase inhibitor activity
GO:0004864	0.370	protein phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0008152	0.978	metabolic process
GO:0050789	0.932	regulation of biological process
GO:0009987	0.925	cellular process
GO:0044237	0.917	cellular metabolic process
GO:0050794	0.884	regulation of cellular process
GO:0019222	0.878	regulation of metabolic process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0031323	0.813	regulation of cellular metabolic process
GO:0080090	0.807	regulation of primary metabolic process
GO:0071704	0.789	organic substance metabolic process
GO:0065009	0.776	regulation of molecular function
GO:0051171	0.693	regulation of nitrogen compound metabolic process
GO:0044092	0.637	negative regulation of molecular function
GO:0043170	0.556	macromolecule metabolic process
GO:0051246	0.450	regulation of protein metabolic process
GO:0006091	0.390	generation of precursor metabolites and energy
GO:0044238	0.336	primary metabolic process
GO:0006807	0.324	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.994	intracellular organelle
GO:0043227	0.990	membrane-bounded organelle
GO:0032991	0.963	protein-containing complex
GO:0120025	0.917	plasma membrane bounded cell projection
GO:1902494	0.914	catalytic complex
GO:0043231	0.912	intracellular membrane-bounded organelle
GO:0005634	0.798	nucleus
GO:0045202	0.738	synapse
GO:0043232	0.578	intracellular non-membrane-bounded organelle
GO:0036477	0.530	somatodendritic compartment
GO:0098794	0.516	postsynapse
GO:0030425	0.512	dendrite
GO:0043197	0.478	dendritic spine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]