StarFunc result for job id O15013

User Input

>input (1369 residues)
MRPPGFLSRAPSLNRAERGIWSCSMDQREPLPPAPAENEMKYDTNNNEEEEGEQFDFDSG
DEIPEADRQAPSAPETGGAGASEAPAPTGGEDGAGAETTPVAEPTKLVLPMKVNPYSVID
ITPFQEDQPPTPVPSAEEENVGLHVPCGYLVPVPCGYAVPSNLPLLLPAYSSPVIICATS
LDEEAETPEVTEDRQPNSLSSEEPPTSEDQVGREDSALARWAADPANTAWMENPEEAIYD
DVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGIPRSFLR
SNHKKQLSHDLTRLKEHYEKKMRDLMASTVGVVEIQQLRQKHELKMQKLVKAAKDGTKDG
LERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQV
VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSL
FQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFL
EFLKQEQEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELET
LAEKLNERKRDADQRCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVK
TKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHVDAIEYGSSAGTGEHS
RHLAVHPPESLAVVANAKPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNL
NQSVAHDWTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIK
ESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAA
YNPEPYLNNESQPDSFSTAHGFLWIGSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCM
LYVPVEEKRREPGAPPDPETPAVRASDVPTICVGTEEGSISIYKSSQGSKKVRLQHFFTP
EKSTVMSLACTSQSLYAGLVNGAVASYARAPDGSWDSEPQKVIKLGVLPVRSLLMMEDTL
WAASGGQVFIISVETHAVEGQLEAHQEEGMVISHMAVSGVGIWIAFTSGSTLRLFHTETL
KHLQDINIATPVHNMLPGHQRLSVTSLLVCHGLLMVGTSLGVLVALPVPRLQGIPKVTGR
GMVSYHAHNSPVKFIVLATALHEKDKDKSRDSLAPGPEPQDEDQKDALPSGGAGSSLSQG
DPDAAIWLGDSLGSMTQKSDLSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKA
RRAKKAKASSALVVCGGQGHRRVHRKARQPHQEELAPTVMVWQIPLLNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15013	1.000	1.000	0.000	1369	1.000	1.000	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
2	AFDB:Q96PE2	0.243	0.167	2.020E-54	2063	0.211	0.140	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
3	AFDB:Q9Y7U6	0.217	0.222	6.888E-25	1334	0.114	0.117	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
4	AFDB:D3DTR7	0.207	0.325	2.724E-15	841	0.098	0.159	D3DTR7.pdb.gz
5	AFDB:Q54DW4	0.191	0.194	4.377E-15	1350	0.093	0.095	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
6	AFDB:E9Q7D5	0.200	0.175	5.291E-15	1581	0.105	0.091	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
7	AFDB:Q6ZNL6	0.138	0.130	6.396E-15	1462	0.118	0.110	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
8	PDB:7rx9A	0.125	0.383	2.541E-11	432	0.056	0.176	7rx9A.pdb.gz
9	PDB:4mt6A	0.189	0.552	3.893E-11	389	0.044	0.154	4mt6A.pdb.gz
10	PDB:6xr4A	0.180	0.234	6.559E-11	1040	0.045	0.059	6xr4A.pdb.gz
11	PDB:7ajuCH	0.200	0.534	1.105E-10	467	0.037	0.109	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:3w15A	0.172	0.649	1.336E-10	336	0.026	0.104	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
13	PDB:5jpqY	0.185	0.632	2.251E-10	365	0.037	0.137	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
14	PDB:7wb4c	0.178	0.647	3.792E-10	346	0.024	0.095	7wb4c.pdb.gz
15	PDB:7lhwA	0.190	0.146	6.698E-10	1813	0.045	0.034	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
16	PDB:7jvrB	0.180	0.652	8.097E-10	342	0.031	0.126	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7d5sBE	0.163	0.251	1.573E-9	865	0.035	0.055	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	AFDB:Q86AD8	0.134	0.150	2.265E-8	1207	0.099	0.112	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
19	AFDB:P91621	0.157	0.114	1.740E-7	2072	0.104	0.069	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
20	AFDB:Q389F7	0.167	0.205	6.565E-7	1105	0.039	0.048	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15013	0.0	2841	1369	1.000	1.000	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
2	Q9HCE6	0.0	929	1279	0.392	0.420	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
3	Q9VX48	1.93e-119	409	1458	0.212	0.199	Q9VX48_DROME SD02996p OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=2
4	M9PEZ9	9.19e-119	409	1563	0.212	0.186	M9PEZ9_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=1
5	E1JJN5	9.59e-119	410	1736	0.211	0.166	E1JJN5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=2
6	M9PHU0	4.37e-118	411	2263	0.211	0.128	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
7	Q96PE2	2.21e-42	172	2063	0.108	0.072	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
8	Q21653	1.01e-28	127	1182	0.066	0.076	OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans OX=6239 GN=osg-1 PE=2 SV=4
9	Q1ZXH8	9.08e-26	118	1632	0.058	0.048	GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum OX=44689 GN=gxcDD PE=4 SV=3
10	Q9GQF1	7.54e-25	115	1227	0.054	0.060	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
11	E9PSK7	3.28e-23	110	1322	0.047	0.049	JIP3_RAT C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2
12	Q54P24	3.63e-23	109	1215	0.052	0.058	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
13	Q9H8V3	5.83e-23	108	914	0.058	0.086	ECT2_HUMAN Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2 PE=1 SV=4
14	Q07139	6.08e-23	108	913	0.061	0.091	ECT2_MOUSE Protein ECT2 OS=Mus musculus OX=10090 GN=Ect2 PE=1 SV=2
15	A0A2R8Q1Z1	1.04e-22	108	980	0.058	0.082	A0A2R8Q1Z1_DANRE Epithelial cell-transforming 2 OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
16	F1QVS6	1.28e-22	107	976	0.058	0.082	F1QVS6_DANRE Epithelial cell-transforming 2 OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
17	Q6DRB9	1.60e-22	107	878	0.058	0.091	Q6DRB9_DANRE Epithelial cell transforming sequence 2 oncogene OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
18	F1LXF1	1.81e-22	107	1270	0.056	0.061	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
19	Q6PAJ1	2.39e-22	107	1270	0.056	0.061	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
20	P11274	2.45e-22	107	1271	0.058	0.063	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19057 PH_19	5.4e-52	187.0	PH domain
2	PF00621 RhoGEF	1.7e-37	140.9	RhoGEF domain
3	PF19056 WD40_2	4.5e-210	710.0	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000024954

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000015578	0.770	Rho guanine nucleotide exchange factor (GEF) 28
2	9593.ENSGGOP00000008542	0.756	Rho guanine nucleotide exchange factor (GEF) 12
3	9593.ENSGGOP00000012527	0.706	Ras homolog family member A
4	9593.ENSGGOP00000022416	0.696	Pleckstrin homology domain containing, family G (with RhoGef domain) member 5
5	9593.ENSGGOP00000010013	0.689	Rho guanine nucleotide exchange factor (GEF) 17
6	9593.ENSGGOP00000004639	0.688	Uncharacterized protein
7	9593.ENSGGOP00000023274	0.682	A kinase (PRKA) anchor protein 13
8	9593.ENSGGOP00000002701	0.663	Ras homolog family member C
9	9593.ENSGGOP00000012875	0.660	Ras homolog family member B
10	9593.ENSGGOP00000003382	0.656	Tripartite motif containing 67
11	9593.ENSGGOP00000027664	0.654	Rho/Rac guanine nucleotide exchange factor (GEF) 2
12	9593.ENSGGOP00000011988	0.647	Transcription elongation regulator 1-like
13	9593.ENSGGOP00000027412	0.644	Uncharacterized protein
14	9593.ENSGGOP00000002620	0.642	Uncharacterized protein
15	9593.ENSGGOP00000011604	0.613	Pleckstrin homology domain containing, family G (with RhoGef domain) member 6
16	9593.ENSGGOP00000017243	0.613	Uncharacterized protein
17	9593.ENSGGOP00000013756	0.605	Pleckstrin homology domain containing, family G (with RhoGef domain) member 7
18	9593.ENSGGOP00000016085	0.595	Dynamin binding protein
19	9593.ENSGGOP00000026757	0.586	Opioid binding protein/cell adhesion molecule-like
20	9593.ENSGGOP00000025053	0.585	Cell division cycle 42

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019894	1.000	kinesin binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.572	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0051056	0.963	regulation of small GTPase mediated signal transduction
GO:0016043	0.886	cellular component organization
GO:0032502	0.867	developmental process
GO:0048856	0.769	anatomical structure development
GO:0032501	0.715	multicellular organismal process
GO:0048522	0.675	positive regulation of cellular process
GO:0006996	0.666	organelle organization
GO:0007275	0.499	multicellular organism development
GO:0048731	0.426	system development
GO:0051128	0.401	regulation of cellular component organization
GO:0007399	0.391	nervous system development
GO:0051493	0.382	regulation of cytoskeleton organization
GO:0044087	0.365	regulation of cellular component biogenesis
GO:1902903	0.344	regulation of supramolecular fiber organization
GO:0050790	0.337	regulation of catalytic activity
GO:0007010	0.328	cytoskeleton organization
GO:0051345	0.328	positive regulation of hydrolase activity
GO:0022607	0.317	cellular component assembly
GO:0030154	0.311	cell differentiation
GO:0022402	0.304	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005856	0.977	cytoskeleton
GO:0015630	0.933	microtubule cytoskeleton
GO:0005813	0.875	centrosome
GO:0016020	0.626	membrane
GO:0043227	0.544	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]