StarFunc result for job id O15014

User Input

>input (1411 residues)
MSLSSGASGGKGVDANPVETYDSGDEWDIGVGNLIIDLDADLEKDQQKLEMSGSKEVGIP
APNAVATLPDNIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE
VQGRSGDGANAGGLVAAIAPKGSEKAAKASRSVAGSKKEKENSSSKSKKERSEGVGTCSE
KDPGVLQPVPLGGRGGQYDGSAGVDTGAVEPLGSIAIEPGAALNPLGTKPEPEEGENECR
LLKKVKSEKMESPVSTPAVLPIHLLVPVVNNDISSPCEQIMVRTRSVGVNTCDVALATEP
ECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTRHDWAPPRFCDSPT
SDLEMRNGRGRGKRMRPNSNTPVNETATASDSKGTSNSSKTRAGANSKGRRGSQNSSEHR
PPASSTSEDVKASPSSANKRKNKPLSDMELNSSSEDSKGSKRVRTNSMGSATGPLPGTKV
EPTVLDRNCPSPVLIDCPHPNCNKKYKHINGLKYHQAHAHTDDDSKPEADGDSEYGEEPI
LHADLGSCNGASVSQKGSLSPARSATPKVRLVEPHSPSPSSKFSTKGLCKKKLSGEGDTD
LGALSNDGSDDGPSVMDETSNDAFDSLERKCMEKEKCKKPSSLKPEKIPSKSLKSARPIA
PAIPPQQIYTFQTATFTAASPGSSSGLTATVAQAMPNSPQLKPIQPKPTVMGEPFTVNPA
LTPAKDKKKKDKKKKESSKELESPLTPGKVCRAEEGKSPFRESSGDGMKMEGLLNGSSDP
HQSRLASIKAEADKIYSFTDNAPSPSIGGSSRLENTTPTQPLTPLHVVTQNGAEASSVKT
NSPAYSDISDAGEDGEGKVDSVKSKDAEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYS
PSYAQSSPGALNPSSQAGVESQALKTKRDEEPESIEGKVKNDICEEKKPELSSSSQQPSV
IQQRPNMYMQSLYYNQYAYVPPYGYSDQSYHTHLLSTNTAYRQQYEEQQKRQSLEQQQRG
VDKKAEMGLKEREAALKEEWKQKPSIPPTLTKAPSLTDLVKSGPGKAKEPGADPAKSVII
PKLDDSSKLPGQAPEGLKVKLSDASHLSKEASEAKTGAECGRQAEMDPILWYRQEAEPRM
WTYVYPAKYSDIKSEDERWKEERDRKLKEERSRSKDSVPKEDGKESTSSDCKLPTSEESR
LGSKEPRPSVHVPVSSPLTQHQSYIPYMHGYSYSQSYDPNHPSYRSMPAVMMQNYPGSYL
PSSYSFSPYGSKVSGGEDADKARASPSVTCKSSSESKALDILQQHASHYKSKSPTISDKT
SQERDRGGCGVVGGGGSCSSVGGASGGERSVDRPRTSPSQRLMSTHHHHHHLGYSLLPAQ
YNLPYAAGLSSTAIVASQQGSTPSLYPPPRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BZ47	0.225	0.225	0.000	1413	0.943	0.942	Q8BZ47.pdb.gz	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
2	AFDB:Q56A10	0.126	0.119	1.893E-68	1511	0.448	0.418	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
3	AFDB:D3ZRA6	0.040	0.035	4.236E-4	1683	0.170	0.143	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
4	AFDB:P29617	0.036	0.031	4.522E-4	1703	0.143	0.119	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
5	AFDB:Q86V38	0.038	0.044	5.504E-4	1191	0.133	0.158	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
6	AFDB:D3Z8E6	0.035	0.032	6.697E-4	1604	0.112	0.099	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
7	AFDB:O88466	0.042	0.034	1.376E-3	1888	0.123	0.092	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
8	AFDB:Q5T5Y3	0.037	0.035	1.568E-3	1602	0.118	0.104	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
9	AFDB:Q09MP3	0.051	0.060	1.788E-3	1159	0.109	0.133	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
10	AFDB:Q3LHL9	0.036	0.032	4.771E-3	1658	0.133	0.113	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
11	PDB:2k8pA	0.024	0.087	6.034E-1	189	0.018	0.138	2k8pA.pdb.gz
12	PDB:3gyxB	0.029	0.154	8.936E-1	166	0.009	0.078	3gyxB.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit
13	PDB:4wspA	0.019	0.238	9.540E-1	79	0.004	0.076	4wspA.pdb.gz
14	PDB:6w18B	0.021	0.066	1.240	367	0.005	0.019	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
15	PDB:3tygL	0.016	0.086	1.323	207	0.004	0.029	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
16	PDB:4c2mI	0.024	0.160	1.323	124	0.006	0.065	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
17	PDB:2luuA	0.030	0.237	1.508	127	0.006	0.071	2luuA.pdb.gz
18	PDB:1lfoA	0.017	0.157	1.610	128	0.003	0.031	1lfoA.pdb.gz	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.
19	PDB:6b2eB	0.021	0.099	1.610	193	0.008	0.057	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:4fl2A	0.024	0.058	1.960	555	0.004	0.011	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15014	0.0	2870	1411	1.000	1.000	ZN609_HUMAN Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2
2	Q56A10	0.0	838	1511	0.470	0.439	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
3	Q8BZ47	0.0	2541	1413	0.943	0.942	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
4	Q9N693	6.80e-50	197	2302	0.097	0.060	Q9N693_DROME Brakeless-B OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
5	Q8T9H1	7.15e-50	197	1928	0.097	0.071	Q8T9H1_DROME SD01229p OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
6	Q9GRA9	7.23e-50	197	2310	0.097	0.059	Q9GRA9_DROME Master of thick veins OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
7	E1JGL0	7.81e-50	197	2312	0.097	0.059	E1JGL0_DROME Scribbler, isoform G OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
8	A0A0B4KEU2	1.03e-49	197	2330	0.097	0.059	A0A0B4KEU2_DROME Scribbler, isoform J OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
9	Q8SX80	2.14e-29	127	555	0.038	0.097	Q8SX80_DROME LD21711p OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
10	Q9NGW5	5.49e-29	128	929	0.038	0.058	Q9NGW5_DROME Brakeless protein OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
11	Q9NBW0	5.82e-29	128	929	0.038	0.058	Q9NBW0_DROME Brakeless-A OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
12	Q9NHQ0	5.92e-29	128	939	0.038	0.058	Q9NHQ0_DROME Scribbler OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
13	A1ZB51	5.97e-29	128	939	0.038	0.058	A1ZB51_DROME Scribbler, isoform F OS=Drosophila melanogaster OX=7227 GN=sbb PE=4 SV=1
14	Q9NBL3	6.03e-29	128	929	0.038	0.058	Q9NBL3_DROME Scribbler short isoform OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
15	Q9UTH8	3.31e-04	47.4	442	0.023	0.075	SFP1_SCHPO Zinc finger protein sfp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfp1 PE=4 SV=1
16	C9JGY8	0.015	40.4	181	0.009	0.072	C9JGY8_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
17	C9JWY1	0.015	40.4	173	0.009	0.075	C9JWY1_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
18	H0Y403	0.070	38.9	230	0.009	0.057	H0Y403_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
19	Q86VZ6	0.11	38.5	243	0.009	0.053	JAZF1_HUMAN Juxtaposed with another zinc finger protein 1 OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=2
20	Q49TU3	0.20	37.7	243	0.009	0.053	Q49TU3_DANRE JAZF zinc finger 1b OS=Danio rerio OX=7955 GN=zgc:103778 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385722	0.764	Integrator complex subunit 1
2	9606.ENSP00000282516	0.754	Nipped-B-like protein
3	9606.ENSP00000445001	0.732	Integrator complex subunit 11
4	9606.ENSP00000318641	0.726	Integrator complex subunit 3
5	9606.ENSP00000327889	0.726	Integrator complex subunit 5
6	9606.ENSP00000310260	0.720	Integrator complex subunit 6
7	9606.ENSP00000355961	0.720	Integrator complex subunit 7
8	9606.ENSP00000381064	0.720	Integrator complex subunit 10
9	9606.ENSP00000414237	0.720	Integrator complex subunit 2
10	9606.ENSP00000415433	0.720	Integrator complex subunit 12
11	9606.ENSP00000429065	0.720	Integrator complex subunit 9
12	9606.ENSP00000430338	0.720	Integrator complex subunit 8
13	9606.ENSP00000434466	0.720	Integrator complex subunit 4
14	9606.ENSP00000322242	0.628	RING finger protein 10
15	9606.ENSP00000408429	0.615	Integrator complex subunit 14
16	9606.ENSP00000304226	0.596	Homeodomain-interacting protein kinase 3
17	9606.ENSP00000478490	0.576	YTH domain-containing family protein 3
18	9606.ENSP00000419124	0.561	Protein FAM107A
19	9606.ENSP00000433664	0.557	Eukaryotic translation initiation factor 4 gamma 2
20	9606.ENSP00000261191	0.540	Integrator complex subunit 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.907	chromatin binding
GO:1990841	0.852	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.920	regulation of metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:0080090	0.882	regulation of primary metabolic process
GO:0031323	0.882	regulation of cellular metabolic process
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0010468	0.815	regulation of gene expression
GO:0042127	0.812	regulation of cell population proliferation
GO:0009889	0.779	regulation of biosynthetic process
GO:0019219	0.770	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.768	regulation of macromolecule biosynthetic process
GO:0031326	0.767	regulation of cellular biosynthetic process
GO:0051252	0.746	regulation of RNA metabolic process
GO:0048518	0.692	positive regulation of biological process
GO:0048522	0.632	positive regulation of cellular process
GO:0051239	0.540	regulation of multicellular organismal process
GO:0050865	0.528	regulation of cell activation
GO:1903506	0.526	regulation of nucleic acid-templated transcription
GO:0002682	0.522	regulation of immune system process
GO:0030155	0.482	regulation of cell adhesion
GO:0051249	0.428	regulation of lymphocyte activation
GO:0009987	0.407	cellular process
GO:0048523	0.400	negative regulation of cellular process
GO:0050793	0.378	regulation of developmental process
GO:0006355	0.371	regulation of DNA-templated transcription
GO:0051173	0.326	positive regulation of nitrogen compound metabolic process
GO:0010604	0.325	positive regulation of macromolecule metabolic process
GO:1902105	0.315	regulation of leukocyte differentiation
GO:0006357	0.308	regulation of transcription by RNA polymerase II
GO:1903037	0.302	regulation of leukocyte cell-cell adhesion
GO:0050863	0.302	regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.908	protein-containing complex
GO:0005737	0.309	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]