StarFunc result for job id O15015

User Input

>input (1832 residues)
MEDTPPSLSCSDCQRHFPSLPELSRHRELLHPSPNQDSEEADSIPRPYRCQQCGRGYRHP
GSLVNHRRTHETGLFPCTTCGKDFSNPMALKSHMRTHAPEGRRRHRPPRPKEATPHLQGE
TVSTDSWGQRLGSSEGWENQTKHTEETPDCESVPDPRAASGTWEDLPTRQREGLASHPGP
EDGADGWGPSTNSARAPPLPIPASSLLSNLEQYLAESVVNFTGGQEPTQSPPAEEERRYK
CSQCGKTYKHAGSLTNHRQSHTLGIYPCAICFKEFSNLMALKNHSRLHAQYRPYHCPHCP
RVFRLPRELLEHQQSHEGERQEPRWEEKGMPTTNGHTDESSQDQLPSAQMLNGSAELSTS
GELEDSGLEEYRPFRCGDCGRTYRHAGSLINHRKSHQTGVYPCSLCSKQLFNAAALKNHV
RAHHRPRQGVGENGQPSVPPAPLLLAETTHKEEEDPTTTLDHRPYKCSECGRAYRHRGSL
VNHRHSHRTGEYQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPD
PVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAESLERHGLTHGAG
EKENSRTETTMSPPRAFACRDCGKSYRHSGSLINHRQTHQTGDFSCGACAKHFHTMAAMK
NHLRRHSRRRSRRHRKRAGGASGGREAKLLAAESWTRELEDNEGLESPQDPSGESPHGAE
GNLESDGDCLQAESEGDKCGLERDETHFQGDKESGGTGEGLERKDASLLDNLDIPGEEGG
GTHFCDSLTGVDEDQKPATGQPNSSSHSANAVTGWQAGAAHTCSDCGHSFPHATGLLSHR
PCHPPGIYQCSLCPKEFDSLPALRSHFQNHRPGEATSAQPFLCCLCGMIFPGRAGYRLHR
RQAHSSSGMTEGSEEEGEEEGVAEAAPARSPPLQLSEAELLNQLQREVEALDSAGYGHIC
GCCGQTYDDLGSLERHHQSQSSGTTADKAPSPLGVAGDAMEMVVDSVLEDIVNSVSGEGG
DAKSQEGAGTPLGDSLCIQGGESLLEAQPRPFRCNQCGKTYRHGGSLVNHRKIHQTGDFL
CPVCSRCYPNLAAYRNHLRNHPRCKGSEPQVGPIPEAAGSSELQVGPIPEGGSNKPQHMA
EEGPGQAEVEKLQEELKVEPLEEVARVKEEVWEETTVKGEEIEPRLETAEKGCQTEASSE
RPFSCEVCGRSYKHAGSLINHRQSHQTGHFGCQACSKGFSNLMSLKNHRRIHADPRRFRC
SECGKAFRLRKQLASHQRVHMERRGGGGTRKATREDRPFRCGQCGRTYRHAGSLLNHRRS
HETGQYSCPTCPKTYSNRMALKDHQRLHSENRRRRAGRSRRTAVRCALCGRSFPGRGSLE
RHLREHEETEREPANGQGGLDGTAASEANLTGSQGLETQLGGAEPVPHLEDGVPRPGERS
QSPIRAASSEAPEPLSWGAGKAGGWPVGGGLGNHSGGWVPQFLTRSEEPEDSVHRSPCHA
GDCQLNGPTLSHMDSWDNRDNSSQLQPGSHSSCSQCGKTYCQSGSLLNHNTNKTDRHYCL
LCSKEFLNPVATKSHSHNHIDAQTFACPDCGKAFESHQELASHLQAHARGHSQVPAQMEE
ARDPKAGTGEDQVVLPGQGKAQEAPSETPRGPGESVERARGGQAVTSMAAEDKERPFRCT
QCGRSYRHAGSLLNHQKAHTTGLYPCSLCPKLLPNLLSLKNHSRTHTDPKRHCCSICGKA
FRTAARLEGHGRVHAPREGPFTCPHCPRHFRRRISFVQHQQQHQEEWTVAGSGAPVAPVT
GRGDLPLPPPPTPTTPLLDPSPQWPADLSFSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15015	1.000	1.000	0.000	1832	1.000	1.000	O15015.pdb.gz	ZN646_HUMAN Zinc finger protein 646 OS=Homo sapiens OX=9606 GN=ZNF646 PE=1 SV=2
2	AFDB:A2A7B5	0.038	0.041	1.305E-14	1709	0.142	0.153	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
3	AFDB:A0A0R4INF0	0.046	0.052	1.880E-14	1570	0.130	0.152	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
4	AFDB:Q13029	0.041	0.042	2.449E-12	1718	0.139	0.148	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
5	AFDB:A0A2R8RT96	0.047	0.065	1.133E-10	1175	0.118	0.184	A0A2R8RT96.pdb.gz
6	AFDB:Q9ULJ3	0.035	0.057	6.619E-10	1066	0.102	0.175	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
7	AFDB:Q9VY72	0.055	0.063	9.536E-10	1553	0.125	0.147	Q9VY72.pdb.gz	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
8	AFDB:A0A0B4K7S6	0.068	0.065	1.552E-9	1965	0.155	0.145	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
9	AFDB:D9YZW0	0.050	0.082	3.221E-9	835	0.088	0.193	D9YZW0.pdb.gz	D9YZW0_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein), isoform CRA_b OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
10	AFDB:Q5T1R4	0.041	0.033	1.306E-8	2406	0.150	0.114	Q5T1R4.pdb.gz	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
11	PDB:3w5kB	0.031	0.252	2.546E-3	110	0.019	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ff79	0.030	0.088	4.776E-1	432	0.016	0.067	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:8a3tU	0.020	0.186	1.429	114	0.011	0.184	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:5apny	0.025	0.109	1.518	211	0.011	0.100	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
15	PDB:5a31B	0.019	0.221	1.715	84	0.010	0.226	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:1b8tA	0.021	0.124	1.822	192	0.017	0.167	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
17	PDB:7c4cA	0.026	0.096	2.790	332	0.009	0.051	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
18	PDB:7uhyA	0.023	0.044	2.790	771	0.009	0.022	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7oqyY	0.011	0.141	3.151	92	0.011	0.217	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
20	PDB:7uhyC	0.020	0.041	4.020	578	0.010	0.033	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15015	0.0	3744	1832	1.000	1.000	ZN646_HUMAN Zinc finger protein 646 OS=Homo sapiens OX=9606 GN=ZNF646 PE=1 SV=2
2	Q05481	9.02e-51	200	1191	0.128	0.197	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	A0A8I6G8Y2	1.98e-38	157	723	0.093	0.235	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
4	Q62788	2.22e-38	157	744	0.093	0.228	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
5	G3V9G6	2.59e-38	157	740	0.093	0.230	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
6	Q8TAQ5	8.97e-38	155	688	0.088	0.234	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
7	Q8BLA2	1.84e-37	152	578	0.088	0.279	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
8	Q7TMN8	2.00e-37	152	578	0.088	0.280	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
9	Q14587	3.64e-37	155	947	0.086	0.166	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
10	Q96SK3	3.52e-36	150	696	0.091	0.239	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
11	Q5U4E2	1.70e-35	146	545	0.084	0.283	REPI1_MOUSE Replication initiator 1 OS=Mus musculus OX=10090 GN=Repin1 PE=1 SV=1
12	Q6ECI4	2.67e-35	147	717	0.081	0.208	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
13	P17038	7.57e-35	147	809	0.079	0.179	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
14	A0A090N8H1	5.65e-34	142	567	0.088	0.286	A0A090N8H1_HUMAN HCG1990708, isoform CRA_c OS=Homo sapiens OX=9606 GN=REPIN1 PE=4 SV=1
15	Q9BWE0	5.65e-34	142	567	0.088	0.286	REPI1_HUMAN Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1
16	P52742	3.11e-33	140	658	0.073	0.202	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
17	P51523	2.07e-32	139	738	0.080	0.199	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
18	Q8K2R5	2.60e-32	137	619	0.088	0.260	ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1
19	Q8N7K0	2.72e-32	138	673	0.080	0.218	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
20	Q9UEG4	4.88e-32	138	869	0.112	0.237	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	18	17.1	BolA-like protein
2	PF00096 zf-C2H2	1.8e-81	275.4	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	9.1	17.5	zinc-finger C2H2-type
4	PF18868 zf-C2H2_3rep	3.5e+02	13.3	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	3.3e-65	222.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1e-11	55.8	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	6.3e-43	155.5	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	1.4e-06	39.7	Zinc-finger double domain
9	PF12874 zf-met	33	16.3	Zinc-finger of C2H2 type
10	PF18439 zf_UBZ	1.9e+02	13.1	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309429	0.660	Probable palmitoyltransferase ZDHHC24
2	9606.ENSP00000356925	0.648	Fc receptor-like B
3	9606.ENSP00000363092	0.647	cGMP-dependent protein kinase 1
4	9606.ENSP00000337854	0.631	Hexosaminidase D
5	9606.ENSP00000355157	0.625	Fc receptor-like protein 2
6	9606.ENSP00000382327	0.624	Epimerase family protein SDR39U1
7	9606.ENSP00000477639	0.621	N-acetyl-D-glucosamine kinase
8	9606.ENSP00000301671	0.618	GH3 domain-containing protein
9	9606.ENSP00000389243	0.603	Zinc finger protein with KRAB and SCAN domains 7
10	9606.ENSP00000320893	0.572	Ankyrin repeat and SOCS box protein 8
11	9606.ENSP00000365477	0.559	Coiled-coil domain-containing protein 93
12	9606.ENSP00000229266	0.553	Cholinephosphotransferase 1
13	9606.ENSP00000308117	0.552	Endosialin
14	9606.ENSP00000355114	0.551	DDB1- and CUL4-associated factor 12
15	9606.ENSP00000384582	0.527	G-protein coupled receptor 98
16	9606.ENSP00000006275	0.526	Trafficking protein particle complex subunit 6A
17	9606.ENSP00000294117	0.518	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.537	organic cyclic compound binding
GO:1901363	0.503	heterocyclic compound binding
GO:0003676	0.313	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.922	cellular process
GO:0065007	0.840	biological regulation
GO:0032502	0.837	developmental process
GO:0050789	0.829	regulation of biological process
GO:0032501	0.791	multicellular organismal process
GO:0048856	0.766	anatomical structure development
GO:0050794	0.697	regulation of cellular process
GO:0007275	0.660	multicellular organism development
GO:0019222	0.518	regulation of metabolic process
GO:0031323	0.368	regulation of cellular metabolic process
GO:0080090	0.349	regulation of primary metabolic process
GO:0060255	0.342	regulation of macromolecule metabolic process
GO:0051171	0.302	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]