StarFunc result for job id O15016

User Input

>input (1216 residues)
MARNCSECKEKRAAHILCTYCNRWLCSSCTEEHRHSPVPGGPFFPRAQKGSPGVNGGPGD
FTLYCPLHTQEVLKLFCETCDMLTCHSCLVVEHKEHRCRHVEEVLQNQRMLLEGVTTQVA
HKKSSLQTSAKQIEDRIFEVKHQHRKVENQIKMAKMVLMNELNKQANGLIEELEGITNER
KRKLEQQLQSIMVLNRQFEHVQNFINWAVCSKTSVPFLFSKELIVFQMQRLLETSCNTDP
GSPWSIRFTWEPNFWTKQLASLGCITTEGGQMSRADAPAYGGLQGSSPFYQSHQSPVAQQ
EALSHPSHKFQSPAVCSSSVCCSHCSPVSPSLKGQVPPPSIHPAHSFRQPPEMVPQQLGS
LQCSALLPREKELACSPHPPKLLQPWLETQPPVEQESTSQRLGQQLTSQPVCIVPPQDVQ
QGAHAQPTLQTPSIQVQFGHHQKLKLSHFQQQPQQQLPPPPPPLPHPPPPLPPPPQQPHP
PLPPSQHLASSQHESPPGPACSQNMDIMHHKFELEEMQKDLELLLQAQQPSLQLSQTKSP
QHLQQTIVGQINYIVRQPAPVQSQSQEETLQATDEPPASQGSKPALPLDKNTAAALPQAS
GEETPLSVPPVDSTIQHSSPNVVRKHSTSLSIMGFSNTLEMELSSTRLERPLEPQIQSVS
NLTAGAPQAVPSLLSAPPKMVSSLTSVQNQAMPSLTTSHLQTVPSLVHSTFQSMPNLISD
SPQAMASLASDHPQAGPSLMSGHTQAVPSLATCPLQSIPPVSDMQPETGSSSSSGRTSGS
LCPRDGADPSLENALCKVKLEEPINLSVKKPPLAPVVSTSTALQQYQNPKECENFEQGAL
ELDAKENQSIRAFNSEHKIPYVRLERLKICAASSGEMPVFKLKPQKNDQDGSFLLIIECG
TESSSMSIKVSQDRLSEATQAPGLEGRKVTVTSLAGQRPPEVEGTSPEEHRLIPRTPGAK
KGPPAPIENEDFCAVCLNGGELLCCDRCPKVFHLSCHVPALLSFPGGEWVCTLCRSLTQP
EMEYDCENACYNQPGMRASPGLSMYDQKKCEKLVLSLCCNNLSLPFHEPVSPLARHYYQI
IKRPMDLSIIRRKLQKKDPAHYTTPEEVVSDVRLMFWNCAKFNYPDSEVAEAGRCLEVFF
EGWLKEIYPEKRFAQPRQEDSDSEEVSSESGCSTPQGFPWPPYMQEGIQPKRRRRHMENE
RAKRMSFRLANSISQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15016	1.000	1.000	0.000	1216	1.000	1.000	O15016.pdb.gz	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
2	AFDB:Q924W6	0.410	0.402	0.000	1242	0.865	0.847	Q924W6.pdb.gz	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
3	AFDB:A0A024R784	0.166	0.196	3.008E-43	1016	0.239	0.286	A0A024R784.pdb.gz
4	AFDB:Q64127	0.159	0.183	3.268E-42	1051	0.237	0.274	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
5	AFDB:Q9U3Y7	0.155	0.165	7.474E-32	1133	0.193	0.207	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
6	PDB:7z36B	0.144	0.350	2.782E-12	446	0.056	0.152	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
7	AFDB:H7C179	0.084	0.116	1.058E-5	861	0.118	0.166	H7C179.pdb.gz	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
8	AFDB:H7C127	0.084	0.112	2.844E-5	892	0.126	0.172	H7C127.pdb.gz	H7C127_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
9	AFDB:Q9UKL3	0.071	0.051	4.380E-4	1982	0.149	0.091	Q9UKL3.pdb.gz	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
10	PDB:4tn3B	0.112	0.302	5.715E-4	362	0.031	0.105	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
11	AFDB:F1LP90	0.082	0.075	1.048E-3	1336	0.097	0.088	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
12	AFDB:A0A0G2K7W4	0.080	0.074	2.818E-3	1348	0.120	0.108	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
13	PDB:7y4sA	0.093	0.278	3.060E-1	343	0.023	0.082	7y4sA.pdb.gz
14	PDB:6tcaA	0.050	0.117	3.862E-1	345	0.018	0.064	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
15	PDB:5apno	0.021	0.188	5.476E-1	105	0.005	0.057	5apno.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:3nr3A	0.024	0.199	5.804E-1	135	0.004	0.037	3nr3A.pdb.gz
17	PDB:7v6cB	0.026	0.116	6.520E-1	260	0.004	0.019	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
18	PDB:2qo5A	0.025	0.210	8.228E-1	129	0.003	0.031	2qo5A.pdb.gz
19	PDB:1f6fA	0.029	0.151	9.797E-1	183	0.021	0.137	1f6fA.pdb.gz
20	PDB:7ajuCE	0.035	0.072	9.797E-1	436	0.013	0.037	7ajuCE.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15016	0.0	2457	1351	0.998	0.899	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
2	Q924W6	0.0	2009	1344	0.865	0.783	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
3	Q32PZ6	9.58e-66	236	607	0.111	0.222	Q32PZ6_RAT Trim24 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Trim24 PE=2 SV=1
4	Q9UPN9	4.50e-64	240	1127	0.095	0.103	TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3
5	Q99PP7	1.18e-63	239	1142	0.094	0.100	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
6	A0A8I6AI80	3.32e-63	236	1050	0.111	0.129	A0A8I6AI80_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1
7	O15164	6.83e-63	236	1050	0.090	0.105	TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3
8	Q64127	2.26e-61	231	1051	0.088	0.102	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
9	Q6E2N3	5.94e-58	221	1163	0.081	0.084	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
10	Q13263	1.15e-41	167	835	0.072	0.105	TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5
11	Q62318	5.45e-41	166	834	0.072	0.104	TIF1B_MOUSE Transcription intermediary factor 1-beta OS=Mus musculus OX=10090 GN=Trim28 PE=1 SV=3
12	O08629	5.53e-41	166	835	0.072	0.104	TIF1B_RAT Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2
13	A0A0B4KGE5	5.98e-33	141	1207	0.062	0.062	A0A0B4KGE5_DROME Bonus, isoform C OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
14	A0A0B4KHT0	7.57e-33	140	1125	0.062	0.067	A0A0B4KHT0_DROME Bonus, isoform E OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
15	A8WHL4	7.70e-33	140	1125	0.062	0.067	A8WHL4_DROME Bonus, isoform B OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
16	Q9VDK5	7.77e-33	140	1133	0.062	0.066	Q9VDK5_DROME Bonus, isoform A OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=2
17	A0A0B4KH12	7.85e-33	140	1119	0.062	0.067	A0A0B4KH12_DROME Bonus, isoform D OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
18	Q9U3Y7	7.90e-33	140	1133	0.062	0.066	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
19	A0A0B4KHG7	9.03e-33	140	1122	0.062	0.068	A0A0B4KHG7_DROME Bonus, isoform F OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
20	M0R0K9	2.96e-27	119	460	0.080	0.211	M0R0K9_HUMAN Tripartite motif containing 28 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	2.3e-12	58.2	Bromodomain
2	PF00628 PHD	0.00013	33.1	PHD-finger
3	PF00643 zf-B_box	0.00017	33.0	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384876

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476960	0.836	Histone cluster 2 H3 pseudogene 2
2	9606.ENSP00000254810	0.825	H3 histone, family 3B (H3.3B)
3	9606.ENSP00000355778	0.825	Histone H3.3
4	9606.ENSP00000339835	0.824	Histone H3.3C
5	9606.ENSP00000333277	0.821	Histone cluster 2 H3 family member d
6	9606.ENSP00000352252	0.821	Histone cluster 1 H3 family member j
7	9606.ENSP00000355657	0.821	Histone H3.1t
8	9606.ENSP00000358154	0.821	Histone cluster 2 H3 family member c
9	9606.ENSP00000358160	0.821	Histone cluster 1 H3 family member h
10	9606.ENSP00000366999	0.821	Histone cluster 1 H3 family member d
11	9606.ENSP00000385479	0.821	Histone H3.2
12	9606.ENSP00000480826	0.821	Histone cluster 1 H3 family member a
13	9606.ENSP00000482271	0.821	Histone cluster 1 H3 family member e
14	9606.ENSP00000483283	0.821	Histone cluster 1 H3 family member i
15	9606.ENSP00000484095	0.821	Histone cluster 1 H3 family member f
16	9606.ENSP00000484638	0.821	Histone cluster 1 H3 family member g
17	9606.ENSP00000484658	0.821	Histone cluster 1 H3 family member c
18	9606.ENSP00000484841	0.821	Histone H3.1
19	9606.ENSP00000346015	0.655	Ribosomal protein L27a
20	9606.ENSP00000295756	0.638	T-cell receptor-associated transmembrane adapter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0042802	0.983	identical protein binding
GO:0003824	0.615	catalytic activity
GO:0097159	0.438	organic cyclic compound binding
GO:1901363	0.428	heterocyclic compound binding
GO:0003676	0.414	nucleic acid binding
GO:0003677	0.366	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0051171	0.951	regulation of nitrogen compound metabolic process
GO:0019219	0.926	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.919	regulation of gene expression
GO:0051252	0.916	regulation of RNA metabolic process
GO:0048519	0.909	negative regulation of biological process
GO:0009889	0.904	regulation of biosynthetic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0048523	0.823	negative regulation of cellular process
GO:0009892	0.788	negative regulation of metabolic process
GO:0010605	0.776	negative regulation of macromolecule metabolic process
GO:0051172	0.754	negative regulation of nitrogen compound metabolic process
GO:0031324	0.710	negative regulation of cellular metabolic process
GO:0009987	0.608	cellular process
GO:0051253	0.562	negative regulation of RNA metabolic process
GO:0045892	0.550	negative regulation of DNA-templated transcription
GO:0050896	0.328	response to stimulus
GO:0048518	0.306	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0005737	0.566	cytoplasm
GO:0016234	0.307	inclusion body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]