StarFunc result for job id O15018

User Input

>input (1400 residues)
MPITQDNAVLHLPLLYQWLQNSLQEGGDGPEQRLCQAAIQKLQEYIQLNFAVDESTVPPD
HSPPEMEICTVYLTKELGDTETVGLSFGNIPVFGDYGEKRRGGKKRKTHQGPVLDVGCIW
VTELRKNSPAGKSGKVRLRDEILSLNGQLMVGVDVSGASYLAEQCWNGGFIYLIMLRRFK
HKAHSTYNGNSSNSSEPGETPTLELGDRTAKKGKRTRKFGVISRPPANKAPEESKGSAGC
EVSSDPSTELENGPDPELGNGHVFQLENGPDSLKEVAGPHLERSEVDRGTEHRIPKTDAP
LTTSNDKRRFSKGGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSGGRGSKRSPHA
IVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVVASKEN
SAEDLLRLTSKSLPDLTSSVEDVSSWTDNEDQEADGEEDEGTSSSVQRAMPGTDEPQDVC
GAEESKGNLESPKQGSNKIKLKSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDGR
KHSLPQLLDSSSASQEYHIVKKSTRSLSTTQVESPWRLIRPSVISIIGLYKEKGKGLGFS
IAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQI
RSGLFVLTVRTKLVSPSLTPCSTPTHMSRSASPNFNTSGGASAGGSDEGSSSSLGRKTPG
PKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGIYIHSLAPGSVAKMESNLSRGDQILE
VNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANS
SPGLGTPLKSPSLAKKDSLISESELSQYFAHDVPGPLSDFMVAGSEDEDHPGSGCSTSEE
GSLPPSTSTHKEPGKPRANSLVTLGSHRASGLFHKQVTVARQASLPGSPQALRNPLLRQR
KVGCYDANDASDEEEFDREGDCISLPGALPGPIRPLSEDDPRRVSISSSKGMDVHNQEER
PRKTLVSKAISAPLLGSSVDLEESIPEGMVDAASYAANLTDSAEAPKGSPGSWWKKELSG
SSSAPKLEYTVRTDTQSPTNTGSPSSPQQKSEGLGSRHRPVARVSPHCKRSEAEAKPSGS
QTVNLTGRANDPCDLDSRVQATSVKVTVAGFQPGGAVEKESLGKLTTGDACVSTSCELAS
ALSHLDASHLTENLPKAASELGQQPMTELDSSSDLISSPGKKGAAHPDPSKTSVDTGQVS
RPENPSQPASPRVTKCKARSPVRLPHEGSPSPGEKAAAPPDYSKTRSASETSTPHNTRRV
AALRGAGPGAEGMTPAGAVLPGDPLTSQEQRQGAPGNHSKALEMTGIHAPESSQEPSLLE
GADSVSSRAPQASLSMLPST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12923	0.074	0.048	2.537E-26	2485	0.164	0.092	Q12923.pdb.gz	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
2	AFDB:A0A2R8QMK9	0.097	0.084	4.065E-22	1689	0.171	0.142	A0A2R8QMK9.pdb.gz
3	AFDB:O97758	0.090	0.075	5.967E-21	1769	0.174	0.138	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
4	AFDB:P39447	0.085	0.071	1.168E-20	1745	0.174	0.139	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
5	AFDB:A0A1D5NS76	0.079	0.061	3.383E-20	2005	0.176	0.123	A0A1D5NS76.pdb.gz
6	PDB:2xkxA	0.100	0.157	2.334E-15	721	0.067	0.130	2xkxA.pdb.gz
7	AFDB:Q99NE5	0.069	0.067	6.620E-13	1463	0.129	0.123	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
8	AFDB:A0A0B4K6Y7	0.089	0.063	4.657E-11	2395	0.156	0.091	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
9	AFDB:A1Z9K8	0.074	0.056	2.640E-10	1871	0.163	0.122	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
10	AFDB:Q9UPX8	0.070	0.067	7.644E-10	1470	0.156	0.149	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
11	AFDB:F1RCC9	0.066	0.078	1.003E-8	1179	0.131	0.156	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
12	PDB:7pc3A	0.064	0.218	1.127E-8	405	0.027	0.094	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.066	0.213	7.993E-8	420	0.024	0.081	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7qqmA	0.062	0.204	1.552E-6	413	0.024	0.080	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7p70A	0.062	0.210	3.397E-6	407	0.023	0.079	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:6t36A	0.060	0.792	3.593E-6	93	0.017	0.258	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
17	PDB:7pc5A	0.058	0.199	4.495E-6	405	0.021	0.074	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:5n7dA	0.062	0.197	1.628E-5	423	0.018	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
19	PDB:7qqnC	0.057	0.188	2.409E-5	414	0.018	0.060	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:3pv2B	0.050	0.146	5.577E-5	388	0.026	0.093	3pv2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15018	0.0	2848	2839	1.000	0.493	PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PDZD2 PE=1 SV=4
2	Q9QZR8	0.0	1924	2766	0.732	0.371	PDZD2_RAT PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Pdzd2 PE=1 SV=1
3	Q14005	5.11e-58	223	1332	0.090	0.095	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
4	O54824	3.50e-52	204	1322	0.095	0.101	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
5	O75970	1.77e-20	101	2070	0.078	0.053	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
6	Q9W283	1.52e-19	98.2	1329	0.034	0.035	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
7	A0A0B4LG21	1.80e-19	97.8	1087	0.034	0.043	A0A0B4LG21_DROME Arc, isoform D OS=Drosophila melanogaster OX=7227 GN=a PE=4 SV=1
8	G5ECZ8	1.64e-17	91.7	2422	0.048	0.028	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
9	Q6R005	4.17e-17	89.7	801	0.054	0.094	DLG4_DANRE Disks large homolog 4 OS=Danio rerio OX=7955 GN=dlg4 PE=2 SV=1
10	Q8VBX6	7.84e-17	89.4	2055	0.048	0.033	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
11	O55164	2.31e-16	87.8	2054	0.058	0.039	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
12	Q63ZW7	2.43e-15	84.3	1834	0.048	0.037	INADL_MOUSE InaD-like protein OS=Mus musculus OX=10090 GN=Patj PE=1 SV=2
13	F1MAD2	9.07e-15	82.4	1836	0.048	0.036	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
14	E2QYC9	2.20e-14	81.3	1828	0.047	0.036	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
15	G5ECY0	2.21e-14	80.9	967	0.058	0.084	DLG1_CAEEL Disks large homolog 1 OS=Caenorhabditis elegans OX=6239 GN=dlg-1 PE=1 SV=1
16	Q62108	2.41e-14	80.5	724	0.055	0.106	DLG4_MOUSE Disks large homolog 4 OS=Mus musculus OX=10090 GN=Dlg4 PE=1 SV=1
17	P31016	4.62e-14	79.7	724	0.049	0.094	DLG4_RAT Disks large homolog 4 OS=Rattus norvegicus OX=10116 GN=Dlg4 PE=1 SV=1
18	P78352	4.70e-14	79.7	724	0.049	0.094	DLG4_HUMAN Disks large homolog 4 OS=Homo sapiens OX=9606 GN=DLG4 PE=1 SV=3
19	Q8NI35	1.03e-13	79.0	1801	0.046	0.036	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
20	Q12959	1.27e-13	78.6	904	0.027	0.042	DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	2.4e-40	148.1	PDZ domain
2	PF13180 PDZ_2	1e-09	49.9	PDZ domain
3	PF17820 PDZ_6	1.3e-18	78.0	PDZ domain
4	PF02163 Peptidase_M50	0.0077	27.1	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374409	0.878	Plakophilin-4
2	9606.ENSP00000307134	0.810	Catenin delta-2
3	9606.ENSP00000366233	0.672	Gamma-aminobutyric acid type B receptor subunit 1
4	9606.ENSP00000386306	0.659	Sodium channel protein type 9 subunit alpha
5	9606.ENSP00000426632	0.652	Erbin
6	9606.ENSP00000318270	0.637	Prominin-2
7	9606.ENSP00000357440	0.605	Heat shock factor protein 2
8	9606.ENSP00000264009	0.592	Heat shock factor protein 4
9	9606.ENSP00000431512	0.566	Heat shock factor protein 1
10	9606.ENSP00000347742	0.532	Na(+)/H(+) exchange regulatory cofactor NHE-RF4
11	9606.ENSP00000344233	0.516	Leucine-rich repeat-containing protein 43
12	9606.ENSP00000357883	0.504	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
13	9606.ENSP00000381448	0.504	Cystatin-C
14	9606.ENSP00000357979	0.502	Nuclear receptor subfamily 2 group E member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.937	cellular process
GO:0065007	0.934	biological regulation
GO:0050794	0.915	regulation of cellular process
GO:0050896	0.890	response to stimulus
GO:0051716	0.782	cellular response to stimulus
GO:0007154	0.759	cell communication
GO:0023052	0.755	signaling
GO:0007165	0.667	signal transduction
GO:0035556	0.385	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.997	cell periphery
GO:0016020	0.997	membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0005829	0.892	cytosol
GO:0005815	0.785	microtubule organizing center
GO:0005813	0.771	centrosome
GO:0005634	0.565	nucleus
GO:0030054	0.537	cell junction
GO:0034451	0.354	centriolar satellite
GO:0070013	0.304	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]