StarFunc result for job id O15020

User Input

>input (2390 residues)
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDL
LYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP
GKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQ
QHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
RAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEF
STQALARQHRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQAR
AGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSI
QNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTR
EANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAW
LGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQC
LFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRH
KKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQ
AFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLF
DANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVE
AIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDE
ILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQRALGAAAAG
PELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDE
LSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLK
ELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFS
RDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAA
YELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQ
DDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELM
LWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYA
AEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAE
LGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPA
PEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLEH
SSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQ
MEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLAR
AQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEP
VVPSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0AHA7	0.277	0.282	0.000	2326	0.449	0.462	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
2	AFDB:F1QQE5	0.741	0.750	0.000	2357	0.538	0.546	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
3	AFDB:O15020	1.000	1.000	0.000	2390	1.000	1.000	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:P11277	0.400	0.438	0.000	2137	0.483	0.540	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
5	AFDB:Q00963	0.243	0.251	0.000	2291	0.468	0.488	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
6	AFDB:Q01082	0.456	0.461	0.000	2364	0.622	0.629	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:Q9H254	0.398	0.373	0.000	2564	0.475	0.443	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
8	AFDB:A4QPE4	0.225	0.531	3.876E-84	934	0.389	0.996	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
9	AFDB:P13395	0.156	0.154	1.676E-65	2415	0.190	0.188	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
10	AFDB:B2R8Y4	0.161	0.371	7.056E-40	901	0.108	0.286	B2R8Y4.pdb.gz	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
11	PDB:4d1eA	0.123	0.291	6.901E-33	859	0.114	0.317	4d1eA.pdb.gz
12	PDB:1sjjA	0.106	0.237	7.463E-28	863	0.103	0.286	1sjjA.pdb.gz
13	PDB:7sx8D	0.081	0.365	1.037E-6	448	0.023	0.121	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7sukSP	0.045	0.046	1.738E-5	2234	0.107	0.114	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:7sicA	0.058	0.055	1.172E-4	2773	0.112	0.097	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
16	PDB:7sqcR1	0.045	0.049	1.344E-4	2080	0.117	0.134	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6hhgA	0.036	0.207	5.255E-4	386	0.009	0.057	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:6u3eA	0.035	0.195	6.302E-4	397	0.009	0.055	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:8escZ	0.044	0.037	8.664E-4	3543	0.102	0.069	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
20	PDB:6bbpA	0.036	0.157	9.488E-4	520	0.009	0.040	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZY6	2773	2152	0.563	0.625	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
2	A0A0G2K677	1857	2561	0.437	0.408	A0A0G2K677_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=1 SV=1
3	A0A140UHX6	2280	2117	0.474	0.535	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
4	A0A8I6ASR7	1857	2542	0.437	0.411	A0A8I6ASR7_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=3 SV=1
5	A0A8I6AWM3	2398	2329	0.515	0.529	A0A8I6AWM3_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
6	A0A8I6G9M6	2380	2325	0.513	0.527	A0A8I6G9M6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
7	A4QPE4	1282	934	0.263	0.673	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
8	A8JNJ6	631	4337	0.146	0.080	A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=2
9	E0AHA7	1974	2326	0.424	0.436	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
10	E9PX29	1858	2561	0.439	0.410	E9PX29_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
11	E9PZC2	640	1241	0.151	0.292	E9PZC2_MOUSE Spectrin beta, non-erythrocytic 4 OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
12	F1QQE5	2533	2357	0.541	0.549	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
13	F6W8M4	4813	2390	0.988	0.988	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
14	F7HAE6	806	3697	0.269	0.174	F7HAE6_MACMU Spectrin beta, non-erythrocytic 5 OS=Macaca mulatta OX=9544 GN=SPTBN5 PE=3 SV=3
15	G3V6S0	3008	2361	0.618	0.625	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
16	G5EBH3	629	3953	0.156	0.094	G5EBH3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
17	G5EC35	629	4063	0.156	0.092	G5EC35_CAEEL Beta chain spectrin homolog Sma1 OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
18	G5EFW3	629	4166	0.156	0.090	G5EFW3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
19	G5EG85	2004	2257	0.431	0.457	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
20	M9PBL6	631	4321	0.146	0.081	M9PBL6_DROME Karst, isoform G OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	4.3e+02	12.3	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF18281 BILBO1_N	64	15.3	BILBO1 N-terminal domain
3	PF11971 CAMSAP_CH	0.0012	29.9	CAMSAP CH domain
4	PF00307 CH	7.5e-45	163.0	Calponin homology (CH) domain
5	PF06294 CH_2	3.4e+02	12.7	CH-like domain in sperm protein
6	PF00169 PH	2.5e-08	45.7	PH domain
7	PF15410 PH_9	2.5e-13	61.7	Pleckstrin homology domain
8	PF00435 Spectrin	2e-265	872.1	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000432568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361824	0.962	Spectrin alpha chain, non-erythrocytic 1
2	9606.ENSP00000221742	0.940	Excitatory amino acid transporter 4
3	9606.ENSP00000256078	0.928	GTPase KRas
4	9606.ENSP00000362680	0.925	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000358548	0.920	GTPase NRas
6	9606.ENSP00000317790	0.918	Spectrin beta, non-erythrocytic 5
7	9606.ENSP00000263373	0.916	Spectrin beta chain, non-erythrocytic 4
8	9606.ENSP00000349960	0.915	Actin, cytoplasmic 1
9	9606.ENSP00000407586	0.908	GTPase HRas
10	9606.ENSP00000354896	0.893	Metabotropic glutamate receptor 1
11	9606.ENSP00000353646	0.852	Puratrophin-1
12	9606.ENSP00000357129	0.842	Spectrin alpha chain, erythrocytic 1
13	9606.ENSP00000349588	0.830	Ankyrin-2
14	9606.ENSP00000280772	0.807	Ankyrin-3
15	9606.ENSP00000265709	0.791	Ankyrin-1
16	9606.ENSP00000352257	0.791	X-ray repair cross-complementing protein 6
17	9606.ENSP00000357177	0.783	Rho guanine nucleotide exchange factor 11
18	9606.ENSP00000452877	0.778	Zinc finger protein 592
19	9606.ENSP00000338481	0.771	Band 4.1-like protein 2
20	9606.ENSP00000252934	0.769	Ataxin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0003779	1.000	actin binding
GO:0098918	0.992	structural constituent of synapse
GO:0005200	0.986	structural constituent of cytoskeleton
GO:0050839	0.905	cell adhesion molecule binding
GO:0045296	0.898	cadherin binding
GO:0099186	0.806	structural constituent of postsynapse
GO:0044877	0.352	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0016043	0.975	cellular component organization
GO:0032501	0.973	multicellular organismal process
GO:0048856	0.953	anatomical structure development
GO:0030534	0.925	adult behavior
GO:0007275	0.902	multicellular organism development
GO:0035264	0.896	multicellular organism growth
GO:0048731	0.891	system development
GO:0034330	0.882	cell junction organization
GO:0007399	0.814	nervous system development
GO:0051179	0.799	localization
GO:0051234	0.788	establishment of localization
GO:0034329	0.774	cell junction assembly
GO:0006810	0.773	transport
GO:0099173	0.721	postsynapse organization
GO:0051128	0.718	regulation of cellular component organization
GO:0021695	0.708	cerebellar cortex development
GO:0007416	0.705	synapse assembly
GO:0016192	0.699	vesicle-mediated transport
GO:0021692	0.698	cerebellar Purkinje cell layer morphogenesis
GO:0044087	0.693	regulation of cellular component biogenesis
GO:1902115	0.649	regulation of organelle assembly
GO:0048518	0.344	positive regulation of biological process
GO:0050896	0.305	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005856	0.997	cytoskeleton
GO:0005829	0.993	cytosol
GO:0032991	0.992	protein-containing complex
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0030054	0.939	cell junction
GO:0005576	0.879	extracellular region
GO:0012505	0.828	endomembrane system
GO:0044297	0.726	cell body
GO:0036477	0.714	somatodendritic compartment
GO:0045202	0.698	synapse
GO:0031982	0.696	vesicle
GO:0045177	0.690	apical part of cell
GO:0005615	0.689	extracellular space
GO:0098978	0.671	glutamatergic synapse
GO:0098794	0.662	postsynapse
GO:0043025	0.661	neuronal cell body
GO:0060076	0.646	excitatory synapse
GO:0099571	0.644	postsynaptic cytoskeleton
GO:0070013	0.620	intracellular organelle lumen
GO:0005634	0.611	nucleus
GO:0098688	0.604	parallel fiber to Purkinje cell synapse
GO:0098590	0.549	plasma membrane region
GO:0015629	0.509	actin cytoskeleton
GO:0070062	0.455	extracellular exosome
GO:0070161	0.453	anchoring junction
GO:0031981	0.452	nuclear lumen
GO:0005938	0.407	cell cortex
GO:0008091	0.376	spectrin
GO:0005911	0.374	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]