StarFunc result for job id O15021

User Input

>input (2623 residues)
MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSRE
HQPPPPPPLGGTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDE
ELDHILSPPPMPFRKCSNPDVASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNP
VAGQAWPASAETSNLVRMRSQALGQSAPSLTASLKELSLPRRGSFCRTSNRKSLIGNGQS
PALPRPHSPLSAHAGNSPQDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNTPS
STVSSSCSSQEKLHQLPYQPTPDELHFLSKHFCTTESIATENRCRNTPMRPRSRSLSPGR
SPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDNVLPLADGVLSFTHHQIIE
LARDCLDKSHQGLITSRYFLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPA
RLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEEMAHLGNYDS
GTAETPETDESVSSSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKK
INKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMK
NMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLM
SMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGC
VPFFGDTPEELFGQVISDEINWPEKDEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQH
RFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHHMETEEEDDTNDEDFNVEIRQ
FSSCSHRFSKVFSSIDRITQNSAEEKEDSVDKTKSTTLPSTETLSWSSEYSEMQQLSTSN
SSDTESNRHKLSSGLLPKLAISTEGEQDEAASCPGDPHEEPGKPALPPEECAQEEPEVTT
PASTISSSTLSVGSFSEHLDQINGRSECVDSTDNSSKPSSEPASHMARQRLESTEKKKIS
GKVTKSLSASALSLMIPGDMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQ
PIVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGE
PVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKTGPARRNSYKSRMVRRSKKSKKKESL
ERRRSLFKKLAKQPSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDF
PSGTNSSQSSSPSSSAPNSPAGSGHIRPSTLHGLAPKLGGQRYRSGRRKSAGNIPLSPLA
RTPSPTPQPTSPQRSPSPLLGHSLGNSKIAQAFPSKMHSPPTIVRHIVRPKSAEPPRSPL
LKRVQSEEKLSPSYGSDKKHLCSRKHSLEVTQEEVQREQSQREAPLQSLDENVCDVPPLS
RARPVEQGCLKRPVSRKVGRQESVDDLDRDKLKAKVVVKKADGFPEKQESHQKSHGPGSD
LENFALFKLEEREKKVYPKAVERSSTFENKASMQEAPPLGSLLKDALHKQASVRASEGAM
SDGRVPAEHRQGGGDFRRAPAPGTLQDGLCHSLDRGISGKGEGTEKSSQAKELLRCEKLD
SKLANIDYLRKKMSLEDKEDNLCPVLKPKMTAGSHECLPGNPVRPTGGQQEPPPASESRA
FVSSTHAAQMSAVSFVPLKALTGRVDSGTEKPGLVAPESPVRKSPSEYKLEGRSVSCLKP
IEGTLDIALLSGPQASKTELPSPESAQSPSPSGDVRASVPPVLPSSSGKKNDTTSARELS
PSSLKMNKSYLLEPWFLPPSRGLQNSPAVSLPDPEFKRDRKGPHPTARSPGTVMESNPQQ
REGSSPKHQDHTTDPKLLTCLGQNLHSPDLARPRCPLPPEASPSREKPGLRESSERGPPT
ARSERSAARADTCREPSMELCFPETAKTSDNSKNLLSVGRTHPDFYTQTQAMEKAWAPGG
KTNHKDGPGEARPPPRDNSSLHSAGIPCEKELGKVRRGVEPKPEALLARRSLQPPGIESE
KSEKLSSFPSLQKDGAKEPERKEQPLQRHPSSIPPPPLTAKDLSSPAARQHCSSPSHASG
REPGAKPSTAEPSSSPQDPPKPVAAHSESSSHKPRPGPDPGPPKTKHPDRSLSSQKPSVG
ATKGKEPATQSLGGSSREGKGHSKSGPDVFPATPGSQNKASDGIGQGEGGPSVPLHTDRA
PLDAKPQPTSGGRPLEVLEKPVHLPRPGHPGPSEPADQKLSAVGEKQTLSPKHPKPSTVK
DCPTLCKQTDNRQTDKSPSQPAANTDRRAEGKKCTEALYAPAEGDKLEAGLSFVHSENRL
KGAERPAAGVGKGFPEARGKGPGPQKPPTEADKPNGMKRSPSATGQSSFRSTALPEKSLS
CSSSFPETRAGVREASAASSDTSSAKAAGGMLELPAPSNRDHRKAQPAGEGRTHMTKSDS
LPSFRVSTLPLESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGR
DVTKPSPAPNTDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60592	0.148	0.217	0.000	1734	0.380	0.575	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
2	AFDB:Q6P0Q8	0.149	0.211	0.000	1798	0.391	0.570	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
3	AFDB:Q9VUQ9	0.152	0.184	9.237E-86	2139	0.263	0.323	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
4	PDB:6byrA	0.112	0.691	2.587E-27	405	0.051	0.328	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
5	AFDB:B2BJC0	0.116	0.271	3.165E-27	1078	0.080	0.194	B2BJC0.pdb.gz	B2BJC0_DANRE Lats2-2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
6	PDB:4mk0A	0.133	0.498	3.471E-25	631	0.046	0.192	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
7	PDB:5x3fB	0.102	0.725	4.745E-25	349	0.047	0.355	5x3fB.pdb.gz
8	PDB:3pfqA	0.112	0.527	6.487E-25	523	0.042	0.210	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
9	PDB:5dykA	0.104	0.329	7.585E-25	809	0.038	0.124	5dykA.pdb.gz
10	AFDB:M9PGC5	0.092	0.098	8.809E-25	2462	0.155	0.165	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
11	PDB:3c4wB	0.113	0.529	8.869E-25	519	0.047	0.235	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
12	PDB:3pvuA	0.128	0.501	1.212E-24	609	0.043	0.187	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	PDB:6pjxA	0.129	0.573	2.042E-24	543	0.042	0.204	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:3nynA	0.129	0.572	3.098E-24	554	0.046	0.217	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
15	AFDB:P53739	0.116	0.322	8.284E-24	893	0.069	0.202	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1
16	PDB:4yhjA	0.124	0.586	2.766E-23	501	0.047	0.248	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
17	AFDB:Q9JIH7	0.095	0.116	2.189E-21	2126	0.144	0.178	Q9JIH7.pdb.gz	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
18	AFDB:X5M5N0	0.093	0.130	2.285E-20	1850	0.113	0.160	X5M5N0.pdb.gz	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
19	AFDB:P83741	0.107	0.117	5.541E-20	2377	0.146	0.162	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
20	AFDB:Q9H4A3	0.102	0.111	3.434E-19	2382	0.154	0.170	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60307	0.0	1349	1309	0.294	0.588	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
2	Q60592	0.0	1609	1734	0.363	0.548	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
3	Q6P0Q8	0.0	1649	1798	0.361	0.527	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
4	Q9R1L5	0.0	1543	1570	0.327	0.547	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
5	Q9Y2H9	0.0	1540	1570	0.331	0.554	MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2
6	Q9VUQ9	8.84e-160	552	2139	0.089	0.109	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
7	Q9LE81	1.91e-91	328	1168	0.063	0.140	IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana OX=3702 GN=IRE PE=2 SV=1
8	F4HYG2	4.85e-88	318	1235	0.067	0.143	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
9	F4J6F6	2.56e-86	314	1296	0.059	0.120	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
10	Q8I4W3	1.18e-71	259	735	0.052	0.185	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
11	O95835	1.75e-69	259	1130	0.055	0.127	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
12	Q8BYR2	6.53e-69	258	1129	0.054	0.126	LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus OX=10090 GN=Lats1 PE=1 SV=3
13	Q9LW66	4.71e-68	244	568	0.050	0.232	Q9LW66_ARATH AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g23310 PE=1 SV=1
14	P47197	7.27e-68	240	481	0.049	0.268	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
15	Q5AP53	3.81e-67	245	732	0.048	0.172	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2
16	Q5RIL6	7.07e-67	251	1068	0.052	0.127	Q5RIL6_DANRE LATS, large tumor suppressor, homolog 1 (Drosophila) OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
17	Q58FB8	1.74e-66	249	1068	0.052	0.127	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
18	M0R0P9	2.28e-66	235	450	0.047	0.276	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
19	Q60823	2.37e-66	236	481	0.049	0.266	AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt2 PE=1 SV=1
20	E1B9D1	2.54e-66	234	438	0.048	0.288	E1B9D1_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.1	19.9	ABC1 atypical kinase-like domain
2	PF01636 APH	0.1	24.0	Phosphotransferase enzyme family
3	PF08926 DUF1908	9e-127	433.5	Domain of unknown function (DUF1908)
4	PF14531 Kinase-like	6.1	17.7	Kinase-like
5	PF00595 PDZ	0.00013	33.6	PDZ domain
6	PF13180 PDZ_2	0.0019	29.9	PDZ domain
7	PF17820 PDZ_6	3e-07	41.6	PDZ domain
8	PF02163 Peptidase_M50	0.0014	29.6	Peptidase family M50
9	PF00069 Pkinase	4.9e-57	204.9	Protein kinase domain
10	PF07714 PK_Tyr_Ser-Thr	6.5e-23	92.9	Protein tyrosine and serine/threonine kinase
11	PF01163 RIO1	1.4e+02	13.5	RIO1 family
12	PF14685 Tricorn_PDZ	7.9	17.9	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262811	0.797	Microtubule associated serine/threonine kinase 3
2	9606.ENSP00000301068	0.653	GTPase RhebL1
3	9606.ENSP00000308279	0.637	Uncharacterized protein C9orf131
4	9606.ENSP00000296597	0.629	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
5	9606.ENSP00000262187	0.570	GTP-binding protein Rheb
6	9606.ENSP00000311360	0.515	Cell cycle checkpoint control protein RAD9A
7	9606.ENSP00000363985	0.512	Myotubularin-related protein 8
8	9606.ENSP00000365919	0.508	WD repeat-containing protein 13
9	9606.ENSP00000402527	0.506	Sentrin-specific protease 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.804	enzyme binding
GO:0019902	0.790	phosphatase binding
GO:0097367	0.569	carbohydrate derivative binding
GO:0043168	0.310	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.982	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0008152	0.951	metabolic process
GO:0050794	0.856	regulation of cellular process
GO:0071704	0.778	organic substance metabolic process
GO:0044238	0.719	primary metabolic process
GO:0044237	0.597	cellular metabolic process
GO:0006807	0.591	nitrogen compound metabolic process
GO:0043170	0.570	macromolecule metabolic process
GO:0032501	0.466	multicellular organismal process
GO:0071840	0.455	cellular component organization or biogenesis
GO:0016043	0.441	cellular component organization
GO:0019222	0.398	regulation of metabolic process
GO:0032502	0.388	developmental process
GO:0019538	0.369	protein metabolic process
GO:0048856	0.348	anatomical structure development
GO:0060255	0.331	regulation of macromolecule metabolic process
GO:0043412	0.331	macromolecule modification
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043229	0.974	intracellular organelle
GO:0005737	0.973	cytoplasm
GO:0043227	0.861	membrane-bounded organelle
GO:0043231	0.853	intracellular membrane-bounded organelle
GO:0016020	0.684	membrane
GO:0043228	0.661	non-membrane-bounded organelle
GO:0043232	0.597	intracellular non-membrane-bounded organelle
GO:0005829	0.549	cytosol
GO:0005634	0.326	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]