StarFunc result for job id O15027

User Input

>input (2357 residues)
MQPPPQTVPSGMAGPPPAGNPRSVFWASSPYRRRANNNAAVAPTTCPLQPVTDPFAFSRQ
ALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPHTHARDSSQGPCEPLPGPLTQPRAH
ASPFSGALTPSAPPGPEMNRSAEVGPSSEPEVQTLPYLPHYIPGVDPETSHGGHPHGNMP
GLDRPLSRQNPHDGVVTPAASPSLPQPGLQMPGQWGPVQGGPQPSGQHRSPCPEGPVPSG
VPCATSVPHFPTPSILHQGPGHEQHSPLVAPPAALPSDGRDEVSHLQSGSHLANNSDPES
TFRQNPRIVNHWASPELRQNPGVKNEHRPASALVNPLARGDSPENRTHHPLGAGAGSGCA
PLEADSGASGALAMFFQGGETENEENLSSEKAGLSGQADFDDFCSSPGLGRPPAPTHVGA
GSLCQALLPGPSNEAAGDVWGDTASTGVPDASGSQYENVENLEFVQNQEVLPSEPLNLDP
SSPSDQFRYGPLPGPAVPRHGAVCHTGAPDATLHTVHPDSVSSSYSSRSHGRLSGSARPQ
ELVGTFIQQEVGKPEDEASGSFFKQIDSSPVGGETDETTVSQNYRGSVSQPSTPSPPKPT
GIFQTSANSSFEPVKSHLVGVKPFEADRANVVGEVRETCVRQKQCRPAAALPDASPGNLE
QPPDNMETLCAPQVCPLPLNSTTEAVHMLPHAGAPPLDTVYPAPEKRPSARTQGPVKCES
PATTLWAQSELPDFGGNVLLAPAAPALYVCAKPQPPVVQPPEEAMSGQQSRNPSSAAPVQ
SRGGIGASENLENPPKMGEEEALQSQASSGYASLLSSPPTESLQNPPVLIAQPDHSYNLA
QPINFSVSLSNSHEKNQSWREALVGDRPAVSSWALGGDSGENTSLSGIPTSSVLSLSLPS
SVAQSNFPQGSGASEMVSNQPANLLVQPPSQPVPENLVPESQKDRKAGSALPGFANSPAG
STSVVLVPPAHGTLVPDGNKANHSSHQEDTYGALDFTLSRTLENPVNVYNPSHSDSLASQ
QSVASHPRQSGPGAPNLDRFYQQVTKDAQGQPGLERAQQELVPPQQQASPPQLPKAMFSE
LSNPESLPAQGQAQNSAQSPASLVLVDAGQQLPPRPPQSSSVSLVSSGSGQAAVPSEQPW
PQPVPALAPGPPPQDLAAYYYYRPLYDAYQPQYSLPYPPEPGAASLYYQDVYSLYEPRYR
PYDGAASAYAQNYRYPEPERPSSRASHSSERPPPRQGYPEGYYSSKSGWSSQSDYYASYY
SSQYDYGDPGHWDRYHYSARVRDPRTYDRRYWCDAEYDAYRREHSAFGDRPEKRDNNWRY
DPRFTGSFDDDPDPHRDPYGEEVDRRSVHSEHSARSLHSAHSLASRRSSLSSHSHQSQIY
RSHNVAAGSYEAPLPPGSFHGDFAYGTYRSNFSSGPGFPEYGYPADTVWPAMEQVSSRPT
SPEKFSVPHVCARFGPGGQLIKVIPNLPSEGQPALVEVHSMEALLQHTSEQEEMRAFPGP
LAKDDTHKVDVINFAQNKAMKCLQNENLIDKESASLLWNFIVLLCRQNGTVVGTDIAELL
LRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTGGPAAAASSLERETER
FRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQTVYQ
LMSGRMPAASTCCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLASRGLLDAAH
FCYLMAQAGFGVYTKKTTKLVLIGSNHSLPFLKFATNEAIQRTEAYEYAQSLGAETCPLP
SFQVFKFIYSCRLAEMGLATQAFHYCEAIAKSILTQPHLYSPVLISQLVQMASQLRLFDP
QLKEKPEEESLAAPTWLVHLQQVERQIKEGAGVWHQDGALPQQCPGTPSSEMEQLDRPGL
SQPGALGIANPLLAVPAPSPEHSSPSVRLLPSAPQTLPDGPLASPARVPMFPVPLPPGPL
EPGPGCVTPGPALGFLEPSGPGLPPGVPPLQERRHLLQEARSPDPGIVPQEAPVGNSLSE
LSEENFDGKFANLTPSRTVPDSEAPPGWDRADSGPTQPPLSLSPAPETKRPGQAAKKETK
EPKKGESWFFRWLPGKKKTEAYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSM
PKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAP
LPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSS
RPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATS
GSSRLGRIGQRKHLVLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QAT4	0.229	0.229	0.000	2357	0.703	0.703	E9QAT4.pdb.gz	SC16A_MOUSE Protein transport protein Sec16A OS=Mus musculus OX=10090 GN=Sec16a PE=1 SV=1
2	AFDB:O15027	1.000	1.000	0.000	2357	1.000	1.000	O15027.pdb.gz	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
3	AFDB:X2JEM2	0.174	0.176	3.238E-35	2326	0.184	0.186	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
4	AFDB:Q6FRV6	0.121	0.127	7.074E-21	2238	0.141	0.148	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1
5	AFDB:P48415	0.118	0.126	1.732E-19	2195	0.128	0.138	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
6	AFDB:E9Q5F9	0.041	0.039	6.002E-7	2537	0.146	0.135	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
7	AFDB:Q9BYW2	0.037	0.036	2.025E-6	2564	0.151	0.139	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
8	PDB:4bzjC	0.097	0.261	5.957E-6	693	0.024	0.082	4bzjC.pdb.gz
9	AFDB:Q9VQM0	0.036	0.038	5.188E-5	2162	0.141	0.154	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
10	AFDB:E1JI78	0.035	0.034	8.908E-5	2528	0.132	0.123	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
11	AFDB:M9PGK7	0.033	0.033	3.289E-4	2272	0.129	0.134	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
12	PDB:5a9q8	0.075	0.254	2.968E-2	434	0.023	0.127	5a9q8.pdb.gz
13	PDB:7fiki	0.067	0.174	3.247E-2	673	0.027	0.094	7fiki.pdb.gz
14	PDB:7tdzC	0.049	0.119	5.330E-2	653	0.032	0.115	7tdzC.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
15	PDB:2y4uA	0.038	0.122	6.676E-2	424	0.022	0.120	2y4uA.pdb.gz
16	PDB:7mq8LP	0.049	0.145	7.306E-2	567	0.025	0.104	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:4j6sB	0.040	0.208	8.363E-2	243	0.014	0.132	4j6sB.pdb.gz	The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.
18	PDB:5ok9B	0.038	0.207	8.748E-2	242	0.015	0.145	5ok9B.pdb.gz
19	PDB:5yqgC	0.034	0.192	9.573E-2	237	0.014	0.135	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
20	PDB:4zdrA	0.035	0.208	1.254E-1	243	0.011	0.107	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3F2YNX0	0.0	4321	2146	0.910	1.000	A0A3F2YNX0_HUMAN Protein transport protein sec16 (Fragment) OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=2
2	E9QAT4	0.0	2898	2357	0.703	0.703	SC16A_MOUSE Protein transport protein Sec16A OS=Mus musculus OX=10090 GN=Sec16a PE=1 SV=1
3	O15027	0.0	4753	2357	1.000	1.000	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
4	Q96JE7	4.09e-138	464	1060	0.101	0.225	SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
5	E9PK14	2.73e-102	345	625	0.078	0.293	E9PK14_HUMAN Protein transport protein sec16 OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
6	Q5BI67	6.71e-60	231	1953	0.070	0.084	Q5BI67_DROME LP14866p OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=2 SV=1
7	A8JUU1	7.93e-60	231	2021	0.070	0.081	A8JUU1_DROME Secretory 16, isoform E OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
8	X2JJP5	8.14e-60	231	2137	0.070	0.077	X2JJP5_DROME Secretory 16, isoform H OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
9	X2JEY9	8.53e-60	231	2242	0.070	0.073	X2JEY9_DROME Secretory 16, isoform J OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
10	M9PHF1	9.23e-60	231	2250	0.070	0.073	M9PHF1_DROME Secretory 16, isoform F OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
11	A8JUU3	3.80e-59	229	2221	0.070	0.074	A8JUU3_DROME Secretory 16, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
12	X2JEM2	3.96e-59	229	2326	0.070	0.071	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
13	P34643	1.68e-28	128	1232	0.051	0.098	SC161_CAEEL Protein transport protein sec-16A.1 OS=Caenorhabditis elegans OX=6239 GN=sec-16A.1 PE=1 SV=1
14	Q9FGK9	8.87e-26	119	1350	0.030	0.053	MAG5_ARATH Protein transport protein SEC16A homolog OS=Arabidopsis thaliana OX=3702 GN=MAG5 PE=1 SV=1
15	O14029	3.07e-08	62.0	1995	0.024	0.028	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
16	P48415	6.85e-06	54.3	2195	0.037	0.040	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
17	Q57WC1	4.36e-04	48.1	1387	0.016	0.027	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
18	Q8I468	4.77e-04	47.0	308	0.020	0.153	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
19	Q8SXX7	0.016	41.2	196	0.018	0.214	Q8SXX7_DROME RE70141p OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=2 SV=1
20	Q6FRV6	0.34	38.9	2238	0.013	0.013	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12932 Sec16	0.00051	32.0	Vesicle coat trafficking protein Sec16 mid-region
2	PF12931 Sec16_C	4.7e-39	146.4	Sec23-binding domain of Sec16

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373312	0.999	Protein SEC13 homolog
2	9606.ENSP00000428564	0.998	Protein transport protein Sec24B
3	9606.ENSP00000378721	0.995	Protein transport protein Sec31A
4	9606.ENSP00000306881	0.992	Protein transport protein Sec23A
5	9606.ENSP00000343405	0.991	Protein transport protein Sec24C
6	9606.ENSP00000260643	0.981	Prolactin regulatory element-binding protein
7	9606.ENSP00000280551	0.981	Protein transport protein Sec24D
8	9606.ENSP00000381823	0.981	Protein transport protein Sec24A
9	9606.ENSP00000240851	0.977	Protein TFG
10	9606.ENSP00000359370	0.966	Protein transport protein Sec31B
11	9606.ENSP00000338844	0.965	Protein transport protein Sec23B
12	9606.ENSP00000385432	0.942	GTP-binding protein SAR1b
13	9606.ENSP00000362339	0.932	GTP-binding protein SAR1a
14	9606.ENSP00000251047	0.905	Protein ERGIC-53
15	9606.ENSP00000380365	0.904	Regucalcin
16	9606.ENSP00000294179	0.870	Syntaxin-5
17	9606.ENSP00000463393	0.867	Vesicle-trafficking protein SEC22b
18	9606.ENSP00000444850	0.863	General vesicular transport factor p115
19	9606.ENSP00000298910	0.856	Leucine-rich repeat serine/threonine-protein kinase 2
20	9606.ENSP00000340900	0.845	Transport and Golgi organization protein 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0048193	0.990	Golgi vesicle transport
GO:0065007	0.963	biological regulation
GO:0051641	0.956	cellular localization
GO:0046907	0.954	intracellular transport
GO:0016043	0.926	cellular component organization
GO:0006996	0.906	organelle organization
GO:0050896	0.905	response to stimulus
GO:0051668	0.879	localization within membrane
GO:0008104	0.876	protein localization
GO:0032501	0.861	multicellular organismal process
GO:0006888	0.833	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0010256	0.826	endomembrane system organization
GO:0032502	0.818	developmental process
GO:0007029	0.779	endoplasmic reticulum organization
GO:0048856	0.689	anatomical structure development
GO:0051716	0.650	cellular response to stimulus
GO:0007275	0.649	multicellular organism development
GO:0006950	0.598	response to stress
GO:0050789	0.480	regulation of biological process
GO:0050794	0.440	regulation of cellular process
GO:0033365	0.370	protein localization to organelle
GO:0033554	0.361	cellular response to stress
GO:0048513	0.311	animal organ development
GO:0065008	0.306	regulation of biological quality
GO:0048731	0.301	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0031090	0.997	organelle membrane
GO:0005829	0.992	cytosol
GO:0042175	0.975	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.966	endoplasmic reticulum membrane
GO:0070971	0.926	endoplasmic reticulum exit site
GO:0098588	0.834	bounding membrane of organelle
GO:0031982	0.764	vesicle
GO:0005794	0.764	Golgi apparatus
GO:0031410	0.727	cytoplasmic vesicle
GO:0005634	0.381	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]