StarFunc result for job id O15031

User Input

>input (1838 residues)
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAK
LQLEQQVATGPALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGIC
ALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCLAASVAAPGSGRVLYAVFSRD
SRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRR
GNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNPEDGIVRA
HMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCA
WCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSV
EPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQML
LEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIA
EPLQSWQPPREAESLQPMTVVGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHRA
LLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMK
TLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
ILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFS
NLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQY
VVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAV
QKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYR
GQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSK
VGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEI
YLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLL
YAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQK
YYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.547	0.522	0.000	1945	0.357	0.338	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.638	0.622	0.000	1902	0.328	0.317	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.579	0.564	0.000	1892	0.337	0.328	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.741	0.740	0.000	1842	0.874	0.872	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.659	0.641	0.000	1902	0.409	0.395	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.455	0.386	0.000	2220	0.432	0.358	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.710	0.702	0.000	1864	0.518	0.511	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	1.000	1.000	0.000	1838	1.000	1.000	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.482	0.422	0.000	2135	0.437	0.377	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.542	0.559	0.000	1766	0.252	0.263	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.216	0.496	3.018E-29	747	0.088	0.216	6vxkB.pdb.gz
12	PDB:6qp7A	0.214	0.580	2.542E-21	620	0.054	0.161	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.200	0.548	6.587E-17	588	0.057	0.179	3nvqA.pdb.gz
14	PDB:3nvnA	0.152	0.625	4.566E-11	383	0.029	0.138	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:7sqcO0	0.068	0.093	3.968E-10	1140	0.046	0.074	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5oj2B	0.063	0.122	2.901E-9	692	0.041	0.110	5oj2B.pdb.gz
17	PDB:7uslA	0.145	0.275	3.029E-9	856	0.060	0.129	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
18	PDB:5a42A	0.086	0.095	5.549E-9	1597	0.049	0.056	5a42A.pdb.gz
19	PDB:5e7gA	0.061	0.178	1.062E-8	446	0.033	0.135	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
20	PDB:7q1yA	0.070	0.084	3.720E-8	1374	0.041	0.055	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	926	1902	0.338	0.326	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	931	1885	0.345	0.337	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	889	1892	0.343	0.334	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	3328	1842	0.876	0.874	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	1778	1864	0.524	0.517	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	1217	1902	0.413	0.400	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	1015	2220	0.313	0.259	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	1783	1864	0.526	0.519	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	936	1928	0.342	0.326	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	3831	1838	1.000	1.000	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	1008	2135	0.304	0.261	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	935	1894	0.344	0.334	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	930	1945	0.343	0.324	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	898	1871	0.339	0.333	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	942	1894	0.349	0.339	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	937	1894	0.345	0.335	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	909	1872	0.345	0.339	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	809	1505	0.283	0.346	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	936	1925	0.359	0.342	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	788	1945	0.319	0.301	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11527 ARL2_Bind_BART	2.6e+02	13.1	The ARF-like 2 binding protein BART
2	PF07047 OPA3	5.7e+02	11.7	Optic atrophy 3 protein (OPA3)
3	PF08192 Peptidase_S64	4.3	17.4	Peptidase family S64
4	PF08337 Plexin_cytopl	8.6e-171	580.3	Plexin cytoplasmic RasGAP domain
5	PF20170 Plexin_RBD	1.4e-32	123.6	Plexin cytoplasmic RhoGTPase-binding domain
6	PF01437 PSI	2.7e-11	55.1	Plexin repeat
7	PF00616 RasGAP	7.5	17.8	GTPase-activator protein for Ras-like GTPase
8	PF01403 Sema	1.6e-17	75.5	Sema domain
9	PF01833 TIG	6.5e-36	133.6	IPT/TIG domain
10	PF17960 TIG_plexin	9.6e-13	59.2	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416523	0.996	Semaphorin-4D
2	9606.ENSP00000308461	0.969	Rho-related GTP-binding protein Rho6
3	9606.ENSP00000357177	0.968	Rho guanine nucleotide exchange factor 11
4	9606.ENSP00000364886	0.964	Rho-related GTP-binding protein RhoE
5	9606.ENSP00000380942	0.956	Rho guanine nucleotide exchange factor 12
6	9606.ENSP00000350547	0.952	Semaphorin-4F
7	9606.ENSP00000303212	0.926	Semaphorin-3E
8	9606.ENSP00000246792	0.924	Ras-related protein R-Ras
9	9606.ENSP00000317272	0.894	Hepatocyte growth factor receptor
10	9606.ENSP00000002829	0.893	Semaphorin-3F
11	9606.ENSP00000261918	0.888	Semaphorin-7A
12	9606.ENSP00000265361	0.888	Semaphorin-3C
13	9606.ENSP00000284136	0.885	Semaphorin-3D
14	9606.ENSP00000265362	0.876	Semaphorin-3A
15	9606.ENSP00000357268	0.865	Semaphorin-4A
16	9606.ENSP00000386394	0.851	NIF3-like protein 1
17	9606.ENSP00000304283	0.845	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000249071	0.836	Ras-related C3 botulinum toxin substrate 2
19	9606.ENSP00000265371	0.831	Neuropilin-1
20	9606.ENSP00000351338	0.830	Plexin-B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.997	transmembrane signaling receptor activity
GO:0017154	0.991	semaphorin receptor activity
GO:0098772	0.435	molecular function regulator activity
GO:0140677	0.425	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.952	response to stimulus
GO:0051128	0.871	regulation of cellular component organization
GO:0048522	0.865	positive regulation of cellular process
GO:0051716	0.831	cellular response to stimulus
GO:0051130	0.809	positive regulation of cellular component organization
GO:0023052	0.808	signaling
GO:0007154	0.802	cell communication
GO:0048856	0.795	anatomical structure development
GO:0120035	0.795	regulation of plasma membrane bounded cell projection organization
GO:0007165	0.768	signal transduction
GO:0007155	0.763	cell adhesion
GO:0032501	0.759	multicellular organismal process
GO:0009893	0.742	positive regulation of metabolic process
GO:0051246	0.729	regulation of protein metabolic process
GO:0071526	0.728	semaphorin-plexin signaling pathway
GO:0051173	0.725	positive regulation of nitrogen compound metabolic process
GO:0007275	0.724	multicellular organism development
GO:0022603	0.719	regulation of anatomical structure morphogenesis
GO:0010604	0.709	positive regulation of macromolecule metabolic process
GO:0031325	0.702	positive regulation of cellular metabolic process
GO:0051247	0.650	positive regulation of protein metabolic process
GO:0048731	0.622	system development
GO:0031326	0.577	regulation of cellular biosynthetic process
GO:0010468	0.576	regulation of gene expression
GO:0010556	0.543	regulation of macromolecule biosynthetic process
GO:0071840	0.521	cellular component organization or biogenesis
GO:0009653	0.520	anatomical structure morphogenesis
GO:0048583	0.475	regulation of response to stimulus
GO:0016043	0.471	cellular component organization
GO:0098609	0.465	cell-cell adhesion
GO:0010975	0.447	regulation of neuron projection development
GO:0048519	0.399	negative regulation of biological process
GO:0048523	0.377	negative regulation of cellular process
GO:0031346	0.376	positive regulation of cell projection organization
GO:0040012	0.363	regulation of locomotion
GO:0030334	0.341	regulation of cell migration
GO:0034248	0.325	regulation of amide metabolic process
GO:2000112	0.324	regulation of cellular macromolecule biosynthetic process
GO:0009966	0.320	regulation of signal transduction
GO:0051239	0.314	regulation of multicellular organismal process
GO:1902531	0.310	regulation of intracellular signal transduction
GO:0030154	0.308	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.990	membrane
GO:0005886	0.984	plasma membrane
GO:0043226	0.977	organelle
GO:0043227	0.974	membrane-bounded organelle
GO:0005576	0.957	extracellular region
GO:0031982	0.863	vesicle
GO:0005615	0.809	extracellular space
GO:0005737	0.741	cytoplasm
GO:0070062	0.725	extracellular exosome
GO:0009986	0.688	cell surface
GO:0043231	0.629	intracellular membrane-bounded organelle
GO:0031012	0.439	extracellular matrix
GO:0062023	0.386	collagen-containing extracellular matrix
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]