StarFunc result for job id O15033

User Input

>input (823 residues)
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQT
FQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFEAY
LYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHPN
PNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAV
VVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15033	1.000	1.000	0.000	823	1.000	1.000	O15033.pdb.gz	AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens OX=9606 GN=AREL1 PE=1 SV=3
2	AFDB:Q54QF1	0.363	0.285	4.936E-43	1120	0.214	0.157	Q54QF1.pdb.gz	Q54QF1_DICDI Ubiquitin-protein ligase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283983 PE=4 SV=1
3	AFDB:Q8T3L0	0.432	0.373	9.200E-30	964	0.182	0.156	Q8T3L0.pdb.gz	Q8T3L0_DROME SD03277p OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=2 SV=1
4	AFDB:P46935	0.428	0.399	1.493E-29	887	0.224	0.207	P46935.pdb.gz	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
5	AFDB:Q9CUN6	0.305	0.342	6.383E-29	731	0.204	0.230	Q9CUN6.pdb.gz	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
6	AFDB:Q92462	0.427	0.457	9.870E-29	767	0.196	0.210	Q92462.pdb.gz	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
7	AFDB:A0A590UJQ1	0.434	0.399	1.320E-28	900	0.214	0.196	A0A590UJQ1.pdb.gz	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
8	AFDB:Q8IYU2	0.415	0.378	2.041E-28	909	0.168	0.152	Q8IYU2.pdb.gz	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
9	AFDB:Q8CFI0	0.431	0.355	2.248E-28	1004	0.199	0.163	Q8CFI0.pdb.gz	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2
10	AFDB:A0A590UJW8	0.428	0.425	2.864E-28	830	0.216	0.214	A0A590UJW8.pdb.gz	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
11	PDB:7jq9A	0.403	0.143	1.754E-24	2427	0.158	0.054	7jq9A.pdb.gz
12	PDB:7mopA	0.377	0.134	7.301E-23	2445	0.148	0.050	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:5c6wJ	0.086	0.240	4.983E-5	238	0.027	0.092	5c6wJ.pdb.gz
14	PDB:6enyC	0.136	0.232	5.762E-5	364	0.034	0.077	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
15	PDB:5oj2B	0.104	0.118	6.048E-5	692	0.046	0.055	5oj2B.pdb.gz
16	PDB:1e07A	0.107	0.124	1.755E-4	642	0.052	0.067	1e07A.pdb.gz
17	PDB:4rtdA	0.088	0.071	3.457E-4	1122	0.106	0.078	4rtdA.pdb.gz
18	PDB:2rcjC	0.107	0.139	3.998E-4	523	0.049	0.076	2rcjC.pdb.gz
19	PDB:7u05C	0.084	0.196	4.623E-4	286	0.038	0.108	7u05C.pdb.gz
20	PDB:7sqcO0	0.117	0.094	4.852E-4	1140	0.064	0.046	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15033	0.0	1722	823	1.000	1.000	AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens OX=9606 GN=AREL1 PE=1 SV=3
2	Q8CHG5	0.0	1684	823	0.972	0.972	AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus OX=10090 GN=Arel1 PE=1 SV=2
3	Q8H0T4	3.07e-67	246	3658	0.186	0.042	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
4	Q8GY23	8.05e-65	239	3681	0.181	0.040	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
5	Q5U1Z5	7.54e-63	220	440	0.165	0.309	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
6	Q62940	4.43e-61	224	887	0.173	0.160	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
7	P46935	7.73e-61	224	887	0.173	0.160	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
8	P46934	1.08e-59	223	1319	0.171	0.107	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
9	A0A8I6AIV5	1.47e-59	220	872	0.165	0.156	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
10	O13834	1.88e-59	223	3227	0.168	0.043	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
11	F1LRN8	2.09e-59	219	856	0.165	0.159	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
12	A0A8I6GKS9	2.84e-59	220	942	0.165	0.144	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
13	A0A0G2JUY1	3.01e-59	219	921	0.165	0.148	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
14	A0A8I6A4L5	3.48e-59	220	976	0.165	0.139	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
15	A0A8I6GL04	3.58e-59	219	912	0.165	0.149	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
16	A0A8I6A6J7	3.64e-59	219	921	0.165	0.148	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
17	A0A8I6GLU0	3.66e-59	219	956	0.165	0.142	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
18	D7NIW0	4.30e-59	219	968	0.165	0.140	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	Q96PU5	4.55e-59	219	975	0.165	0.139	NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2
20	Q8CFI0	4.69e-59	219	1004	0.165	0.135	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00630 Filamin	1.6e-07	43.4	Filamin/ABP280 repeat
2	PF00632 HECT	5.4e-75	264.3	HECT-domain (ubiquitin-transferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348714

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363019	0.930	Ubiquitin-conjugating enzyme E2 D1
2	9606.ENSP00000400906	0.842	Ubiquitin-conjugating enzyme E2L 3
3	9606.ENSP00000344393	0.765	rRNA-processing protein FCF1 homolog
4	9606.ENSP00000286544	0.763	Protein FAM161B
5	9606.ENSP00000377369	0.761	Leucine-rich repeat-containing protein 74A
6	9606.ENSP00000257575	0.755	Ring finger protein, transmembrane 2
7	9606.ENSP00000441543	0.739	Polyubiquitin-C
8	9606.ENSP00000452280	0.695	Prostaglandin reductase 2
9	9606.ENSP00000451812	0.686	Protein lin-52 homolog
10	9606.ENSP00000352925	0.669	Transformation/transcription domain-associated protein
11	9606.ENSP00000373696	0.650	E3 ubiquitin-protein ligase TRIP12
12	9606.ENSP00000388550	0.637	RING finger protein 24
13	9606.ENSP00000443176	0.631	Ring finger and SPRY domain containing 1
14	9606.ENSP00000216420	0.595	Cell growth regulator with RING finger domain protein 1
15	9606.ENSP00000312439	0.554	E3 ubiquitin-protein ligase RNF26
16	9606.ENSP00000262971	0.543	E3 SUMO-protein ligase PIAS4
17	9606.ENSP00000460348	0.531	Pre-mRNA-processing-splicing factor 8
18	9606.ENSP00000381717	0.519	Ubiquitin-conjugating enzyme E2 D2
19	9606.ENSP00000376258	0.517	E3 ubiquitin-protein ligase RNF34
20	9606.ENSP00000307208	0.510	Nucleosome-remodeling factor subunit BPTF

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0019538	0.995	protein metabolic process
GO:0036211	0.993	protein modification process
GO:0050789	0.988	regulation of biological process
GO:0019941	0.975	modification-dependent protein catabolic process
GO:0070647	0.974	protein modification by small protein conjugation or removal
GO:0006511	0.974	ubiquitin-dependent protein catabolic process
GO:0050794	0.961	regulation of cellular process
GO:0016567	0.932	protein ubiquitination
GO:0048519	0.824	negative regulation of biological process
GO:0048523	0.717	negative regulation of cellular process
GO:0048583	0.455	regulation of response to stimulus
GO:0000209	0.419	protein polyubiquitination
GO:0019222	0.348	regulation of metabolic process
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0031981	0.938	nuclear lumen
GO:0005654	0.924	nucleoplasm
GO:0012505	0.627	endomembrane system
GO:0016020	0.345	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]