StarFunc result for job id O15034

User Input

>input (1052 residues)
MREAAERRQQLQLEHDQALAVLSAKQQEIDLLQKSKVRELEEKCRTQSEQFNLLSRDLEK
FRQHAGKIDLLGGSAVAPLDISTAPSKPFPQFMNGLATSLGKGQESAIGGSSAIGEYIRP
LPQPGDRPEPLSAKPTFLSRSGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNP
FDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLA
STLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYP
RKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYNVLVDKETRMNLTLGSRTKALIEKLNMA
ACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSH
VIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFS
TLPAGPPAPPQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVI
FPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELLVPPTPHPRPAPQSK
PLASSGVPETKDEHLGPHARMDEAWEQSRAPGPVHGHMLEPPVGPGRRSPSPSRILPQPQ
GTPVSTTVAKAMAREAAQRVAESSRLEKRSVFLERSSAGQYAASDEEDAYDSPDFKRRGA
SVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLSDIMEEDEEELYSEMQLEDGGRRRPSG
TSHNALKILGNPASAGRVDHMGRRFPRGSAGPQRSRPVTVPSIDDYGRDRLSPDFYEESE
TDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETC
ARLGLIPCNMVSEIQADDEEMMDQLLRQGFLPLNTPVEKIERSRRSGRRHSVSTRRMVAL
YDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDD
VEVYLSDAPSHYSQDTPMRSKAKRKKSVHFTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15034	1.000	1.000	0.000	1052	1.000	1.000	O15034.pdb.gz	RIMB2_HUMAN RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=RIMBP2 PE=1 SV=3
2	AFDB:Q80U40	0.458	0.450	0.000	1072	0.856	0.840	Q80U40.pdb.gz	RIMB2_MOUSE RIMS-binding protein 2 OS=Mus musculus OX=10090 GN=Rimbp2 PE=1 SV=3
3	AFDB:Q9UFD9	0.182	0.120	5.867E-53	1639	0.263	0.169	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
4	AFDB:Q3V0F0	0.210	0.144	3.065E-52	1606	0.259	0.169	Q3V0F0.pdb.gz	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
5	AFDB:Q92859	0.088	0.067	2.555E-14	1461	0.140	0.101	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
6	AFDB:A0A2R8QRK0	0.121	0.094	1.480E-13	1420	0.136	0.101	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	AFDB:Q2Q0I9	0.110	0.074	3.751E-13	1779	0.145	0.086	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
8	AFDB:A0A0G2JZA1	0.114	0.085	1.169E-12	1512	0.144	0.101	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
9	AFDB:Q9VZT8	0.088	0.068	6.106E-12	1443	0.111	0.081	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
10	AFDB:O55005	0.111	0.076	7.130E-12	1651	0.106	0.068	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	PDB:8eyyA	0.099	0.126	1.326E-11	775	0.050	0.068	8eyyA.pdb.gz
12	PDB:8dtlA	0.098	0.127	9.445E-11	741	0.048	0.069	8dtlA.pdb.gz
13	PDB:6pxvA	0.098	0.118	6.389E-10	823	0.048	0.062	6pxvA.pdb.gz
14	PDB:6pyhD	0.099	0.122	1.619E-9	798	0.054	0.071	6pyhD.pdb.gz
15	PDB:1griA	0.061	0.270	4.867E-6	211	0.042	0.209	1griA.pdb.gz
16	PDB:7u7nC	0.073	0.316	5.984E-6	200	0.029	0.155	7u7nC.pdb.gz
17	PDB:7z0lB	0.100	0.218	5.984E-6	370	0.029	0.081	7z0lB.pdb.gz
18	PDB:2lqnA	0.058	0.181	6.988E-6	303	0.035	0.122	2lqnA.pdb.gz
19	PDB:6dldD	0.084	0.224	9.527E-6	269	0.031	0.123	6dldD.pdb.gz
20	PDB:7bwaA	0.078	0.112	2.178E-5	674	0.029	0.045	7bwaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15034	0.0	2167	1052	1.000	1.000	RIMB2_HUMAN RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=RIMBP2 PE=1 SV=3
2	Q80U40	0.0	1808	1072	0.857	0.841	RIMB2_MOUSE RIMS-binding protein 2 OS=Mus musculus OX=10090 GN=Rimbp2 PE=1 SV=3
3	Q9JIR1	0.0	1774	1049	0.844	0.847	RIMB2_RAT RIMS-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Rimbp2 PE=1 SV=2
4	O95153	1.83e-118	403	1857	0.252	0.143	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
5	Q7TNF8	2.86e-112	385	1846	0.249	0.142	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
6	Q9JIR0	1.42e-98	345	1847	0.190	0.108	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
7	A0A0B4JDC9	1.17e-61	233	1844	0.157	0.089	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
8	Q86BS0	1.21e-61	232	1473	0.157	0.112	Q86BS0_DROME RIM-binding protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
9	A0A0B4JCX2	1.37e-61	233	1817	0.157	0.091	A0A0B4JCX2_DROME RIM-binding protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
10	E1JIL7	1.57e-61	232	1791	0.157	0.092	E1JIL7_DROME RIM-binding protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
11	A0A126GUV2	2.21e-61	232	1765	0.155	0.092	A0A126GUV2_DROME RIM-binding protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
12	A0A0B4KGQ6	2.43e-61	231	1763	0.155	0.092	A0A0B4KGQ6_DROME RIM-binding protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
13	Q9VF66	2.45e-61	231	1748	0.155	0.093	Q9VF66_DROME RIM-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=5
14	Q86BP0	6.82e-60	227	1487	0.152	0.108	Q86BP0_DROME RIM-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
15	A0A0B4KG12	8.32e-60	227	1799	0.154	0.090	A0A0B4KG12_DROME RIM-binding protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
16	Q9UFD9	4.57e-54	209	1639	0.142	0.091	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
17	Q9N415	9.32e-54	207	1276	0.143	0.118	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
18	Q3V0F0	1.03e-32	140	1606	0.069	0.045	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
19	Q9JLQ0	2.50e-10	67.0	637	0.048	0.078	CD2AP_MOUSE CD2-associated protein OS=Mus musculus OX=10090 GN=Cd2ap PE=1 SV=3
20	F1LRS8	3.64e-10	66.2	637	0.052	0.086	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	7.3e-10	50.4	Fibronectin type III domain
2	PF00018 SH3_1	4e-12	56.9	SH3 domain
3	PF07653 SH3_2	6.3e-29	110.9	Variant SH3 domain
4	PF14604 SH3_9	1.6e-23	93.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261655

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262231	0.969	Regulating synaptic membrane exocytosis protein 2
2	9606.ENSP00000428417	0.941	Regulating synaptic membrane exocytosis protein 1
3	9606.ENSP00000282878	0.852	Ras-related protein Rab-3C
4	9606.ENSP00000288139	0.850	Voltage-dependent L-type calcium channel subunit alpha-1D
5	9606.ENSP00000241014	0.814	C-Jun-amino-terminal kinase-interacting protein 1
6	9606.ENSP00000367756	0.775	Protein unc-13 homolog B
7	9606.ENSP00000353362	0.763	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
8	9606.ENSP00000222256	0.750	Ras-related protein Rab-3A
9	9606.ENSP00000429562	0.750	Protein unc-13 homolog A
10	9606.ENSP00000296452	0.736	Protein bassoon
11	9606.ENSP00000468263	0.709	ELKS/Rab6-interacting/CAST family member 1
12	9606.ENSP00000360423	0.683	Voltage-dependent N-type calcium channel subunit alpha-1B
13	9606.ENSP00000260323	0.664	Protein unc-13 homolog C
14	9606.ENSP00000275954	0.658	Transmembrane protein 47
15	9606.ENSP00000367476	0.647	Centrosomal protein of 104 kDa
16	9606.ENSP00000379563	0.643	Translocator protein
17	9606.ENSP00000255448	0.641	Serine/threonine-protein kinase DCLK1
18	9606.ENSP00000407193	0.632	Arylsulfatase G
19	9606.ENSP00000319991	0.618	Monocarboxylate transporter 7
20	9606.ENSP00000288221	0.615	ERC protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0032879	0.878	regulation of localization
GO:0051049	0.870	regulation of transport
GO:0009987	0.862	cellular process
GO:0065008	0.835	regulation of biological quality
GO:0060627	0.816	regulation of vesicle-mediated transport
GO:0042391	0.773	regulation of membrane potential
GO:0051128	0.756	regulation of cellular component organization
GO:0031338	0.606	regulation of vesicle fusion
GO:0050896	0.319	response to stimulus
GO:0048518	0.317	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0005737	1.000	cytoplasm
GO:0030054	0.997	cell junction
GO:0045202	0.993	synapse
GO:0098793	0.978	presynapse
GO:0048786	0.945	presynaptic active zone
GO:0043226	0.936	organelle
GO:0005886	0.914	plasma membrane
GO:0042995	0.885	cell projection
GO:0120025	0.872	plasma membrane bounded cell projection
GO:0043229	0.840	intracellular organelle
GO:0005938	0.837	cell cortex
GO:0099568	0.830	cytoplasmic region
GO:0043227	0.715	membrane-bounded organelle
GO:0099738	0.705	cell cortex region
GO:0098831	0.667	presynaptic active zone cytoplasmic component
GO:0043005	0.603	neuron projection
GO:0030424	0.468	axon
GO:0098978	0.404	glutamatergic synapse
GO:0005829	0.374	cytosol
GO:0043231	0.316	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]