StarFunc result for job id O15040

User Input

>input (1411 residues)
MASISEPVTFREFCPLYYLLNAIPTKIQKGFRSIVVYLTALDTNGDYIAVGSSIGMLYLY
CRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRF
DVTGIHKNSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCNSQLVLEEPSSIVQLDY
SQKVLLVSTLQRSLLFYTEEKSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGL
RLWKADVHGTVQATFILKDAFAGGVKPFELHPRLESPNSGSCSLPERHLGLVSCFFQEGW
VLSWNEYSIYLLDTVNQATVAGLEGSGDIVSVSCTENEIFFLKGDRNIIRISSRPEGLTS
TVRDGLEMSGCSERVHVQQAEKLPGATVSETRLRGSSMASSVASEPRSRSSSLNSTDSGS
GLLPPGLQATPELGKGSQPLSQRFNAISSEDFDQELVVKPIKVKRKKKKKKTEGGSRSTC
HSSLESTPCSEFPGDSPQSLNTDLLSMTSSVLGSSVDQLSAESPDQESSFNGEVNGVPQE
NTDPETFNVLEVSGSMPDSLAEEDDIRTEMPHCHHAHGRELLNGAREDVGGSDVTGLGDE
PCPADDGPNSTQLPFQEQDSSPGAHDGEDIQPIGPQSTFCEVPLLNSLTVPSSLSWAPSA
EQWLPGTRADEGSPVEPSQEQDILTSMEASGHLSTNLWHAVTDDDTGQKEIPISERVLGS
VGGQLTPVSALAASTHKPWLEQPPRDQTLTSSDEEDIYAHGLPSSSSETSVTELGPSCSQ
QDLSRLGAEDAGLLKPDQFAESWMGYSGPGYGILSLVVSEKYIWCLDYKGGLFCSALPGA
GLRWQKFEDAVQQVAVSPSGALLWKIEQKSNRAFACGKVTIKGKRHWYEALPQAVFVALS
DDTAWIIRTSGDLYLQTGLSVDRPCARAVKVDCPYPLSQITARNNVVWALTEQRALLYRE
GVSSFCPEGEQWKCDIVSERQALEPVCITLGDQQTLWALDIHGNLWFRTGIISKKPQGDD
DHWWQVSITDYVVFDQCSLFQTIIHATHSVATAAQAPVEKVADKLRMAFWSQQLQCQPSL
LGVNNSGVWISSGKNEFHVAKGSLIGTYWNHVVPRGTASATKWAFVLASAAPTKEGSFLW
LCQSSKDLCSVSAQSAQSRPSTVQLPPEAEMRAYAACQDALWALDSLGQVFIRTLSKSCP
TGMHWTRLDLSQLGAVKLTSLACGNQHIWACDSRGGVYFRVGTQPLNPSLMLPAWIMIEP
PVQPAGVSLVSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALS
TRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRL
TKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15040	1.000	1.000	0.000	1411	1.000	1.000	O15040.pdb.gz	TCPR2_HUMAN Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4
2	PDB:6lqsBE	0.135	0.218	9.177E-13	823	0.045	0.077	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
3	PDB:7d5sBE	0.161	0.223	1.169E-12	865	0.047	0.076	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
4	PDB:7mq8LT	0.171	0.253	1.287E-12	869	0.048	0.078	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7d4iBE	0.154	0.209	1.895E-12	890	0.043	0.067	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
6	PDB:5wyjBE	0.140	0.242	3.914E-12	753	0.043	0.080	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
7	PDB:7mqaLQ	0.134	0.211	4.525E-12	830	0.044	0.075	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:1nr0A	0.140	0.297	9.345E-12	610	0.049	0.113	1nr0A.pdb.gz
9	PDB:7mq8LR	0.141	0.237	1.249E-11	773	0.043	0.079	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7mqaLO	0.138	0.224	1.311E-11	819	0.038	0.066	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:2hyeA	0.149	0.176	1.444E-11	1140	0.043	0.054	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
12	AFDB:Q389F7	0.171	0.213	1.209E-10	1105	0.086	0.110	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
13	AFDB:F4HTH8	0.170	0.201	2.267E-10	1181	0.083	0.099	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
14	AFDB:M9PB01	0.164	0.101	1.292E-9	2397	0.101	0.060	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
15	AFDB:O43379	0.145	0.136	1.902E-9	1518	0.090	0.084	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
16	AFDB:A0A1P8AW69	0.172	0.233	1.997E-9	1019	0.085	0.118	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
17	AFDB:Q9C0J8	0.170	0.179	1.254E-8	1336	0.081	0.085	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
18	AFDB:Q92834	0.139	0.183	2.685E-6	1020	0.083	0.115	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
19	AFDB:Q8I5B3	0.155	0.253	3.767E-6	822	0.071	0.122	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
20	AFDB:A0A0G2K490	0.088	0.090	4.355E-6	1360	0.078	0.081	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15040	0.0	2901	1411	1.000	1.000	TCPR2_HUMAN Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4
2	P59438	3.54e-23	109	1126	0.072	0.090	HPS5_MOUSE BLOC-2 complex member HPS5 OS=Mus musculus OX=10090 GN=Hps5 PE=1 SV=2
3	Q9UPZ3	4.98e-22	106	1129	0.072	0.089	HPS5_HUMAN BLOC-2 complex member HPS5 OS=Homo sapiens OX=9606 GN=HPS5 PE=1 SV=2
4	F6NLH0	4.06e-20	99.8	1133	0.067	0.084	F6NLH0_DANRE Hermansky-Pudlak syndrome 5 protein homolog OS=Danio rerio OX=7955 GN=zgc:162420 PE=3 SV=1
5	Q0VA83	4.36e-20	99.8	1174	0.067	0.081	Q0VA83_DANRE LOC560531 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC560531 PE=2 SV=1
6	Q9VHN9	3.21e-14	80.5	826	0.067	0.115	HPS5_DROME BLOC-2 complex member HPS5 homolog OS=Drosophila melanogaster OX=7227 GN=p PE=2 SV=1
7	Q7Z6L1	3.60e-09	63.9	1165	0.036	0.044	TCPR1_HUMAN Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1 PE=1 SV=1
8	Q6NLV4	0.005	43.9	647	0.023	0.049	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
9	F4K3Y7	0.006	43.5	657	0.023	0.049	F4K3Y7_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=2
10	Q383N1	0.017	42.4	975	0.031	0.045	Q383N1_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2250 PE=4 SV=1
11	O74184	0.099	38.9	314	0.021	0.096	WAT1_SCHPO Target of rapamycin complex subunit wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop3 PE=1 SV=1
12	Q57ZE4	0.12	39.3	1027	0.036	0.050	Q57ZE4_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.250 PE=4 SV=1
13	C8VF02	0.14	39.3	836	0.024	0.041	C8VF02_EMENI SepB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10635 PE=4 SV=1
14	Q389P0	0.14	38.9	580	0.019	0.047	Q389P0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.1070 PE=4 SV=1
15	Q92466	0.16	38.5	427	0.022	0.073	DDB2_HUMAN DNA damage-binding protein 2 OS=Homo sapiens OX=9606 GN=DDB2 PE=1 SV=1
16	Q5JKX0	0.24	38.1	527	0.021	0.055	Q5JKX0_ORYSJ Putative FY protein OS=Oryza sativa subsp. japonica OX=39947 GN=B1147A04.35 PE=2 SV=1
17	Q54PT8	0.43	37.7	1272	0.018	0.020	Q54PT8_DICDI PH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284337 PE=4 SV=1
18	Q9SJK6	0.51	37.4	1082	0.026	0.034	WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana OX=3702 GN=WBC30 PE=1 SV=3
19	Q8NDV3	1.0	36.2	1235	0.012	0.014	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3
20	P0A110	1.2	35.8	449	0.027	0.085	NDOB_PSEPU Naphthalene 1,2-dioxygenase system, large oxygenase component OS=Pseudomonas putida OX=303 GN=ndoB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	7.7	18.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF06462 Hyd_WA	1.4e-38	141.6	Propeller
3	PF19193 Tectonin	5.1e-22	89.9	Tectonin domain
4	PF00400 WD40	2.8	20.1	WD domain, G-beta repeat
5	PF17005 WD40_like	2.6e+02	12.3	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280551	0.799	Protein transport protein Sec24D
2	9606.ENSP00000349785	0.742	Microtubule-associated proteins 1A/1B light chain 3C
3	9606.ENSP00000235329	0.718	Mitofusin-2
4	9606.ENSP00000360268	0.717	Delta-1-pyrroline-5-carboxylate synthase
5	9606.ENSP00000309457	0.687	Vacuolar protein sorting-associated protein 41 homolog
6	9606.ENSP00000324318	0.678	Trafficking protein particle complex subunit 12
7	9606.ENSP00000251119	0.675	Zinc finger FYVE domain-containing protein 26
8	9606.ENSP00000369810	0.674	Vacuolar protein sorting-associated protein 16 homolog
9	9606.ENSP00000282041	0.672	Ectopic P granules protein 5 homolog
10	9606.ENSP00000220509	0.666	Vacuolar protein sorting-associated protein 18 homolog
11	9606.ENSP00000355672	0.663	Putative transferase CAF17, mitochondrial
12	9606.ENSP00000410964	0.662	Erlin-1
13	9606.ENSP00000253233	0.656	Probable peptide chain release factor C12orf65, mitochondrial
14	9606.ENSP00000367590	0.648	Receptor expression-enhancing protein 2
15	9606.ENSP00000348848	0.639	WD repeat domain phosphoinositide-interacting protein 4
16	9606.ENSP00000316335	0.622	Phenylalanine--tRNA ligase, mitochondrial
17	9606.ENSP00000037243	0.614	Gamma-aminobutyric acid receptor-associated protein-like 2
18	9606.ENSP00000470262	0.613	Trafficking protein particle complex subunit 5
19	9606.ENSP00000377282	0.609	Protrudin
20	9606.ENSP00000283351	0.603	Trafficking protein particle complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046907	0.993	intracellular transport
GO:0006886	0.962	intracellular protein transport
GO:0032527	0.933	protein exit from endoplasmic reticulum
GO:0008152	0.417	metabolic process
GO:0065007	0.386	biological regulation
GO:0050789	0.380	regulation of biological process
GO:0050794	0.363	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0016020	0.996	membrane
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0031090	0.931	organelle membrane
GO:0012505	0.870	endomembrane system
GO:0005829	0.758	cytosol
GO:0043228	0.753	non-membrane-bounded organelle
GO:0098588	0.674	bounding membrane of organelle
GO:0043232	0.664	intracellular non-membrane-bounded organelle
GO:0032991	0.616	protein-containing complex
GO:0070013	0.531	intracellular organelle lumen
GO:0031982	0.422	vesicle
GO:0005634	0.388	nucleus
GO:0031410	0.303	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]