StarFunc result for job id O15041

User Input

>input (775 residues)
MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHT
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15041	1.000	1.000	0.000	775	1.000	1.000	O15041.pdb.gz	SEM3E_HUMAN Semaphorin-3E OS=Homo sapiens OX=9606 GN=SEMA3E PE=1 SV=1
2	AFDB:O42237	0.955	0.943	0.000	785	0.815	0.805	O42237.pdb.gz	SEM3E_CHICK Semaphorin-3E OS=Gallus gallus OX=9031 GN=SEMA3E PE=2 SV=1
3	AFDB:Q1LYS1	0.880	0.887	0.000	768	0.586	0.591	Q1LYS1.pdb.gz	Q1LYS1_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E OS=Danio rerio OX=7955 GN=fj37c11 PE=3 SV=1
4	AFDB:M9MM97	0.862	0.866	5.874E-101	771	0.499	0.502	M9MM97.pdb.gz	M9MM97_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3bl OS=Danio rerio OX=7955 GN=fc22d04 PE=3 SV=1
5	AFDB:Q4LFA9	0.841	0.835	1.756E-98	780	0.503	0.500	Q4LFA9.pdb.gz	SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 GN=Sema3g PE=2 SV=1
6	AFDB:Q9NS98	0.871	0.863	1.095E-97	782	0.512	0.508	Q9NS98.pdb.gz	SEM3G_HUMAN Semaphorin-3G OS=Homo sapiens OX=9606 GN=SEMA3G PE=1 SV=1
7	AFDB:O08665	0.850	0.853	7.584E-97	772	0.480	0.482	O08665.pdb.gz	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
8	AFDB:R4GJE6	0.845	0.804	2.159E-96	815	0.465	0.442	R4GJE6.pdb.gz
9	AFDB:M9MM94	0.850	0.850	4.723E-95	775	0.471	0.471	M9MM94.pdb.gz
10	AFDB:Q9W7J1	0.838	0.757	5.822E-95	860	0.441	0.398	Q9W7J1.pdb.gz	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1
11	PDB:6qp7A	0.666	0.823	6.789E-52	620	0.232	0.290	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.652	0.844	6.698E-43	588	0.206	0.272	3nvqA.pdb.gz
13	PDB:3nvnA	0.436	0.842	1.576E-20	383	0.092	0.185	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.406	0.419	1.143E-15	747	0.125	0.130	6vxkB.pdb.gz
15	PDB:6jp6A	0.199	0.162	6.696E-8	998	0.057	0.044	6jp6A.pdb.gz
16	PDB:7wb4c	0.285	0.554	1.906E-7	346	0.057	0.127	7wb4c.pdb.gz
17	PDB:7tdzD	0.285	0.527	3.215E-7	375	0.053	0.109	7tdzD.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
18	PDB:5y31B	0.261	0.367	1.188E-6	511	0.043	0.065	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
19	PDB:1yfqA	0.261	0.509	3.957E-6	342	0.065	0.146	1yfqA.pdb.gz	The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions.
20	PDB:5nnzA	0.283	0.578	5.139E-6	335	0.062	0.143	5nnzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PZ68	664	751	0.419	0.433	A0A1D5PZ68_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=3 SV=1
2	A0A2R8Q5T8	648	791	0.413	0.405	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
3	E7F6C0	650	787	0.414	0.408	E7F6C0_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
4	F1NVZ5	753	808	0.479	0.459	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
5	M9MM97	811	771	0.501	0.503	M9MM97_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3bl OS=Danio rerio OX=7955 GN=fc22d04 PE=3 SV=1
6	O08665	778	772	0.481	0.483	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
7	O15041	1628	775	1.000	1.000	SEM3E_HUMAN Semaphorin-3E OS=Homo sapiens OX=9606 GN=SEMA3E PE=1 SV=1
8	O42236	660	751	0.418	0.431	SEM3C_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=2 SV=1
9	O42237	1330	785	0.801	0.791	SEM3E_CHICK Semaphorin-3E OS=Gallus gallus OX=9031 GN=SEMA3E PE=2 SV=1
10	O88632	651	785	0.426	0.420	SEM3F_MOUSE Semaphorin-3F OS=Mus musculus OX=10090 GN=Sema3f PE=2 SV=2
11	P70275	1461	775	0.902	0.902	SEM3E_MOUSE Semaphorin-3E OS=Mus musculus OX=10090 GN=Sema3e PE=1 SV=3
12	Q13214	667	749	0.439	0.454	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
13	Q13275	657	785	0.443	0.437	SEM3F_HUMAN Semaphorin-3F OS=Homo sapiens OX=9606 GN=SEMA3F PE=2 SV=2
14	Q14563	778	771	0.481	0.484	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
15	Q1LYS1	953	768	0.588	0.594	Q1LYS1_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E OS=Danio rerio OX=7955 GN=fj37c11 PE=3 SV=1
16	Q4LFA9	761	780	0.507	0.504	SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 GN=Sema3g PE=2 SV=1
17	Q62181	670	751	0.428	0.442	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2
18	Q63548	780	772	0.483	0.484	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
19	Q8BH34	731	777	0.453	0.452	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
20	Q90607	754	772	0.479	0.481	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	1.4e-05	36.5	Immunoglobulin domain
2	PF13927 Ig_3	1.5e+02	14.3	Immunoglobulin domain
3	PF18452 Ig_6	0.18	23.1	Immunoglobulin domain
4	PF01437 PSI	5.6e+02	12.5	Plexin repeat
5	PF01403 Sema	1.6e-58	209.1	Sema domain
6	PF07686 V-set	0.23	23.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303212

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317128	0.999	Plexin-D1
2	9606.ENSP00000265371	0.988	Neuropilin-1
3	9606.ENSP00000246792	0.954	Ras-related protein R-Ras
4	9606.ENSP00000258526	0.950	Plexin-C1
5	9606.ENSP00000466680	0.937	Rho-related GTP-binding protein RhoN
6	9606.ENSP00000409171	0.926	Plexin-B2
7	9606.ENSP00000265382	0.900	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
8	9606.ENSP00000352882	0.889	Plexin-A4
9	9606.ENSP00000356000	0.889	Plexin-A2
10	9606.ENSP00000377061	0.887	Plexin-A1
11	9606.ENSP00000351338	0.886	Plexin-B1
12	9606.ENSP00000358696	0.886	Plexin-A3
13	9606.ENSP00000442736	0.886	Plexin-B3
14	9606.ENSP00000353582	0.827	Neuropilin-2
15	9606.ENSP00000173229	0.698	Netrin-1
16	9606.ENSP00000344277	0.676	Docking protein 4
17	9606.ENSP00000263923	0.659	Vascular endothelial growth factor receptor 2
18	9606.ENSP00000372160	0.658	Docking protein 6
19	9606.ENSP00000364000	0.630	Collagen alpha-2(V) chain
20	9606.ENSP00000478570	0.620	Vascular endothelial growth factor A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030215	0.994	semaphorin receptor binding
GO:0038191	0.985	neuropilin binding
GO:0098772	0.955	molecular function regulator activity
GO:0140677	0.934	molecular function activator activity
GO:0030546	0.783	signaling receptor activator activity
GO:0048018	0.707	receptor ligand activity
GO:0038023	0.536	signaling receptor activity
GO:0004888	0.406	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0048856	0.992	anatomical structure development
GO:0032501	0.987	multicellular organismal process
GO:0023052	0.979	signaling
GO:0007275	0.978	multicellular organism development
GO:0007154	0.976	cell communication
GO:0007165	0.970	signal transduction
GO:0048731	0.964	system development
GO:0048519	0.926	negative regulation of biological process
GO:0071526	0.897	semaphorin-plexin signaling pathway
GO:0030154	0.893	cell differentiation
GO:0009653	0.890	anatomical structure morphogenesis
GO:0007399	0.880	nervous system development
GO:0048523	0.869	negative regulation of cellular process
GO:0048468	0.828	cell development
GO:0030182	0.819	neuron differentiation
GO:0048513	0.812	animal organ development
GO:0048518	0.810	positive regulation of biological process
GO:0022603	0.779	regulation of anatomical structure morphogenesis
GO:0048522	0.778	positive regulation of cellular process
GO:0048583	0.708	regulation of response to stimulus
GO:0010646	0.673	regulation of cell communication
GO:0023051	0.672	regulation of signaling
GO:0009966	0.652	regulation of signal transduction
GO:0071840	0.649	cellular component organization or biogenesis
GO:1902531	0.642	regulation of intracellular signal transduction
GO:0048666	0.626	neuron development
GO:0016043	0.614	cellular component organization
GO:0051239	0.532	regulation of multicellular organismal process
GO:0051128	0.470	regulation of cellular component organization
GO:0030155	0.422	regulation of cell adhesion
GO:0040012	0.403	regulation of locomotion
GO:0010941	0.392	regulation of cell death
GO:2000145	0.365	regulation of cell motility
GO:0030334	0.347	regulation of cell migration
GO:0048584	0.334	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043226	0.435	organelle
GO:0043227	0.416	membrane-bounded organelle
GO:0071944	0.357	cell periphery
GO:0005886	0.323	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]