StarFunc result for job id O15042

User Input

>input (1029 residues)
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESA
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKK
DKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERS
HKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRS
HKKSKKNKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15042	1.000	1.000	0.000	1029	1.000	1.000	O15042.pdb.gz	SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2
2	AFDB:Q9VJ87	0.062	0.052	1.741E-5	1330	0.157	0.122	Q9VJ87.pdb.gz	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
3	AFDB:A0A1D8PRZ6	0.077	0.087	5.211E-5	861	0.113	0.135	A0A1D8PRZ6.pdb.gz	A0A1D8PRZ6_CANAL Pin4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIN4 PE=4 SV=1
4	AFDB:Q57TU8	0.084	0.123	1.216E-4	666	0.056	0.087	Q57TU8.pdb.gz	Q57TU8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.520 PE=4 SV=1
5	PDB:7oqcF	0.078	0.290	2.382E-4	267	0.026	0.101	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
6	PDB:6c0fo	0.074	0.517	5.029E-4	133	0.018	0.143	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
7	PDB:6gd1A	0.074	0.376	8.278E-4	190	0.018	0.100	6gd1A.pdb.gz
8	AFDB:A0A140UHY3	0.085	0.128	9.380E-4	661	0.066	0.103	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
9	AFDB:Q9LEY4	0.130	0.096	9.380E-4	1445	0.127	0.091	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
10	AFDB:F1R0M4	0.082	0.149	9.859E-4	541	0.049	0.092	F1R0M4.pdb.gz	F1R0M4_DANRE FUS RNA-binding protein OS=Danio rerio OX=7955 GN=zgc:56390 PE=1 SV=1
11	PDB:3lqvB	0.073	0.594	1.233E-3	115	0.017	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14
12	PDB:6ff7X	0.071	0.380	1.363E-3	171	0.027	0.164	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:5lsbA	0.071	0.401	1.432E-3	176	0.016	0.091	5lsbA.pdb.gz
14	AFDB:A0A0K3AU72	0.065	0.048	1.544E-3	1698	0.128	0.078	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
15	PDB:6y53o	0.069	0.422	1.582E-3	160	0.017	0.106	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7dvqY	0.073	0.480	1.748E-3	140	0.016	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:7ohxo	0.075	0.604	2.030E-3	112	0.019	0.179	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	AFDB:Q10145	0.075	0.100	2.188E-3	738	0.055	0.077	Q10145.pdb.gz	YAS9_SCHPO Uncharacterized RNA-binding protein C3H8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.09c PE=4 SV=1
19	AFDB:B5BM24	0.075	0.068	2.300E-3	1159	0.113	0.100	B5BM24.pdb.gz	B5BM24_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifg-1 PE=1 SV=2
20	PDB:5yzg1	0.072	0.293	2.738E-3	243	0.017	0.074	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ET15	0.0	2094	1028	0.997	0.998	E7ET15_HUMAN U2 snRNP associated SURP domain containing OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=1
2	O15042	0.0	2106	1029	1.000	1.000	SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2
3	H7C4V2	2.88e-134	408	290	0.237	0.841	H7C4V2_HUMAN U2 snRNP associated SURP domain containing (Fragment) OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=1
4	Q57XU8	1.28e-11	70.9	613	0.032	0.054	Q57XU8_TRYB2 RNA binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.20 PE=4 SV=1
5	Q0J9Y2	5.22e-10	65.1	425	0.033	0.080	RBPL_ORYSJ RNA-binding protein L OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-L PE=1 SV=1
6	Q9LJH8	7.27e-10	64.7	427	0.024	0.059	UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana OX=3702 GN=UBP1C PE=1 SV=1
7	F4I3B3	1.02e-09	64.3	445	0.032	0.074	RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
8	Q9LEB4	1.14e-09	63.9	409	0.030	0.076	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
9	Q9SX79	1.97e-09	63.5	432	0.031	0.074	RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana OX=3702 GN=RBP47C PE=2 SV=1
10	Q9SX80	2.00e-09	63.5	434	0.031	0.074	R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana OX=3702 GN=RBP47C' PE=2 SV=1
11	Q0WW84	2.04e-09	63.5	435	0.031	0.074	RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana OX=3702 GN=RBP47B PE=1 SV=1
12	Q2UNI5	3.64e-09	62.8	477	0.025	0.055	Q2UNI5_ASPOR RRM domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000353 PE=4 SV=1
13	Q9LEB3	3.65e-09	62.4	428	0.031	0.075	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
14	Q9SYG4	6.23e-09	62.0	426	0.023	0.056	UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana OX=3702 GN=UBP1A PE=1 SV=1
15	Q93W34	9.31e-09	61.2	415	0.029	0.072	RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana OX=3702 GN=RBP45C PE=2 SV=1
16	Q9LQI9	4.28e-08	59.3	419	0.022	0.055	UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana OX=3702 GN=UBP1B PE=1 SV=1
17	P32831	5.30e-08	59.3	672	0.029	0.045	NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NGR1 PE=1 SV=2
18	Q10200	6.00e-08	58.9	466	0.048	0.105	YBY1_SCHPO Uncharacterized protein C11C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11C11.01 PE=1 SV=2
19	F4HV67	1.05e-07	57.8	430	0.025	0.060	F4HV67_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana OX=3702 GN=UBP1A PE=1 SV=1
20	Q3V2M1	1.07e-07	56.6	266	0.029	0.113	Q3V2M1_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pabpc2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	7.5e-05	34.4	CID domain
2	PF12243 CTK3	0.14	23.5	CTD kinase subunit gamma CTK3
3	PF08312 cwf21	1.1e-06	39.9	cwf21 domain
4	PF00076 RRM_1	6.8e-11	53.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF16367 RRM_7	27	16.3	RNA recognition motif
6	PF11767 SET_assoc	41	15.2	Histone lysine methyltransferase SET associated
7	PF01805 Surp	3e-15	67.3	Surp module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9646.ENSAMEP00000013461

Rank	PPI partner	STRING score	Description
1	9646.ENSAMEP00000002243	0.982	RNA binding motif protein 17
2	9646.ENSAMEP00000014570	0.967	Splicing factor 3b, subunit 1, 155kDa
3	9646.ENSAMEP00000010588	0.943	Calcium homeostasis endoplasmic reticulum protein
4	9646.ENSAMEP00000018824	0.943	Uncharacterized protein
5	9646.ENSAMEP00000000908	0.934	Small nuclear ribonucleoprotein polypeptide E
6	9646.ENSAMEP00000002325	0.934	Splicing factor 3b, subunit 3, 130kDa
7	9646.ENSAMEP00000005771	0.930	Splicing factor 3a subunit 2
8	9646.ENSAMEP00000006761	0.929	poly-U binding splicing factor 60KDa
9	9646.ENSAMEP00000011057	0.923	Uncharacterized protein
10	9646.ENSAMEP00000014687	0.917	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
11	9646.ENSAMEP00000018203	0.916	Splicing factor 3b, subunit 2, 145kDa
12	9646.ENSAMEP00000002692	0.913	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
13	9646.ENSAMEP00000016887	0.900	Small nuclear ribonucleoprotein polypeptide G
14	9646.ENSAMEP00000005552	0.899	Survival motor neuron domain containing 1
15	9646.ENSAMEP00000002933	0.895	Splicing factor 3b, subunit 6, 14kDa
16	9646.ENSAMEP00000000843	0.889	Small nuclear ribonucleoprotein D2 polypeptide
17	9646.ENSAMEP00000015744	0.874	Uncharacterized protein
18	9646.ENSAMEP00000017204	0.873	RNA binding motif protein 25
19	9646.ENSAMEP00000008196	0.860	Uncharacterized protein
20	9646.ENSAMEP00000018881	0.847	DEAD-box helicase 46

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0044238	0.984	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0051252	0.969	regulation of RNA metabolic process
GO:0010468	0.967	regulation of gene expression
GO:0016070	0.966	RNA metabolic process
GO:0016071	0.930	mRNA metabolic process
GO:0006397	0.912	mRNA processing
GO:0008380	0.829	RNA splicing
GO:0000375	0.684	RNA splicing, via transesterification reactions
GO:0000398	0.590	mRNA splicing, via spliceosome
GO:0048518	0.323	positive regulation of biological process
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.953	protein-containing complex
GO:0140513	0.605	nuclear protein-containing complex
GO:1990904	0.513	ribonucleoprotein complex
GO:0005681	0.372	spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]