StarFunc result for job id O15047

User Input

>input (1707 residues)
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETAESRRRSSSDTAAYPAGTTAVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSSSSSSSSSQFR
SSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRP
TDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCT
PPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGDDMEISDDDRGGSPPPAPTP
PQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFV
NSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLIAASAGPPGGAFGEAFLPFPP
PQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEARLPPREEAELA
EGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA
AKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEP
SEISEASEEKRPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFA
LDSEGEEASQESSSEKDEEDDEEDEEDEDREEAVDTTKKETEVSDGEDEESDSSSKCSLY
ADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEDEEEEERPAALPSASPP
PREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAGPTEESPPSAPLRPPEPPAGP
PAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAKFPGPASRKAP
RGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRLTEEEEAEPGTEVDLAVLADLA
LTPARRGLPALPAVEDSEATETSDEAERPRPLLSHILLEHNYALAVKPTPPAPALRPPEP
VPAPAALFSSPADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSS
SSSDGEGALRRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDM
SYLRLTYERLLQQTSGADWLNDTHWVHHTITNLTTPKRKRRPQDGPREHQTGSARSEGYY
PISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKL
NQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIG
SSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEI
TYDYKFPLEDNKIPCLCGTESCRGSLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PYH6	0.254	0.253	0.000	1716	0.906	0.901	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
2	AFDB:Q8CFT2	0.266	0.238	4.577E-90	1985	0.445	0.382	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
3	AFDB:Q9UPS6	0.228	0.208	5.146E-90	1966	0.443	0.385	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
4	AFDB:Q1LY77	0.230	0.220	1.432E-84	1844	0.404	0.374	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
5	AFDB:Q5LJZ2	0.192	0.198	2.113E-60	1641	0.248	0.258	Q5LJZ2.pdb.gz	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
6	AFDB:Q18221	0.132	0.148	2.638E-43	1507	0.215	0.244	Q18221.pdb.gz	SET2_CAEEL Histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans OX=6239 GN=set-2 PE=1 SV=2
7	AFDB:Q9VYD1	0.097	0.073	8.925E-13	2313	0.155	0.115	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
8	AFDB:Q2LAE1	0.085	0.083	2.279E-12	1759	0.116	0.113	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
9	AFDB:Q9BYW2	0.087	0.058	2.880E-12	2564	0.172	0.114	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
10	PDB:7td5A	0.068	0.231	4.013E-12	497	0.028	0.097	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:5hynA	0.071	0.204	8.104E-12	581	0.028	0.083	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
12	PDB:7td5F	0.068	0.256	9.662E-12	447	0.028	0.107	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	AFDB:Q9VW15	0.088	0.069	2.238E-11	2226	0.145	0.111	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
14	PDB:5wg6A	0.070	0.226	1.917E-10	517	0.028	0.091	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
15	PDB:6wkrC	0.069	0.191	2.569E-10	606	0.028	0.078	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
16	PDB:7ksoA	0.067	0.287	4.615E-10	395	0.028	0.122	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
17	PDB:1pegA	0.073	0.440	2.337E-8	266	0.023	0.150	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:6qx91K	0.052	0.402	6.590E-7	201	0.017	0.144	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:6y53o	0.045	0.466	1.891E-6	160	0.010	0.106	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
20	PDB:5h6zA	0.061	0.710	2.850E-6	123	0.014	0.195	5h6zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PYH6	0.0	2485	1716	0.884	0.879	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
2	O15047	0.0	3430	1707	1.000	1.000	SET1A_HUMAN Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3
3	Q1LY77	1.50e-131	455	1844	0.123	0.114	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
4	Q9UPS6	1.23e-121	426	1966	0.125	0.109	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
5	Q8CFT2	5.10e-121	425	1985	0.124	0.107	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
6	Q5LJZ2	1.11e-100	360	1641	0.103	0.107	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
7	Q9Y7R4	1.39e-67	249	920	0.073	0.135	SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set1 PE=1 SV=1
8	Q18221	1.79e-66	251	1507	0.064	0.073	SET2_CAEEL Histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans OX=6239 GN=set-2 PE=1 SV=2
9	Q54HS3	3.17e-63	241	1486	0.062	0.071	SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum OX=44689 GN=set1 PE=1 SV=1
10	Q5ABG1	5.01e-61	231	1040	0.070	0.115	SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SET1 PE=3 SV=1
11	P38827	1.09e-57	221	1080	0.060	0.095	SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SET1 PE=1 SV=1
12	F4K1J4	6.38e-54	210	1423	0.057	0.068	ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana OX=3702 GN=ATXR7 PE=2 SV=1
13	P20659	2.91e-40	167	3726	0.042	0.019	TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster OX=7227 GN=trx PE=1 SV=4
14	P55200	9.38e-40	165	3966	0.046	0.020	KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus OX=10090 GN=Kmt2a PE=1 SV=3
15	Q03164	9.47e-40	165	3969	0.046	0.020	KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5
16	F1M0L3	1.06e-39	165	3986	0.046	0.020	F1M0L3_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2a PE=1 SV=4
17	A8VKP8	3.33e-38	160	4218	0.045	0.018	A8VKP8_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
18	F1QL52	3.94e-38	160	4219	0.045	0.018	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
19	Q9UMN6	1.33e-37	158	2715	0.045	0.028	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1
20	O08550	1.39e-37	158	2713	0.045	0.028	KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus OX=10090 GN=Kmt2b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11764 N-SET	1.5e-15	69.2	COMPASS (Complex proteins associated with Set1p) component N
2	PF00076 RRM_1	0.013	26.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF00856 SET	9.7e-12	57.1	SET domain
4	PF02919 Topoisom_I_N	1.8e+02	13.1	Eukaryotic DNA topoisomerase I, DNA binding fragment

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264515	0.999	Retinoblastoma-binding protein 5
2	9606.ENSP00000296490	0.999	WD repeat-containing protein 82
3	9606.ENSP00000309555	0.999	Host cell factor 1
4	9606.ENSP00000340896	0.999	Set1/Ash2 histone methyltransferase complex subunit ASH2
5	9606.ENSP00000345837	0.999	Protein dpy-30 homolog
6	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
7	9606.ENSP00000390475	0.999	CXXC-type zinc finger protein 1
8	9606.ENSP00000307208	0.972	Nucleosome-remodeling factor subunit BPTF
9	9606.ENSP00000337088	0.957	Menin
10	9606.ENSP00000442924	0.951	Histone-lysine N-methyltransferase SETD1B
11	9606.ENSP00000312379	0.945	Histone-lysine N-methyltransferase 2E
12	9606.ENSP00000358151	0.927	Histone H2B type 2-E
13	9606.ENSP00000362300	0.926	Protein argonaute-1
14	9606.ENSP00000381657	0.923	Histone-lysine N-methyltransferase, H3 lysine-79 specific
15	9606.ENSP00000362306	0.920	Protein argonaute-4
16	9606.ENSP00000362287	0.918	Protein argonaute-3
17	9606.ENSP00000336783	0.909	Trinucleotide repeat-containing gene 6C protein
18	9606.ENSP00000383042	0.905	Lysine-specific histone demethylase 1A
19	9606.ENSP00000399797	0.905	Putative helicase MOV-10
20	9606.ENSP00000329380	0.902	Platelet glycoprotein Ib alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042800	1.000	histone H3K4 methyltransferase activity
GO:0097159	0.704	organic cyclic compound binding
GO:1901363	0.687	heterocyclic compound binding
GO:0003676	0.681	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0032502	0.981	developmental process
GO:0051128	0.980	regulation of cellular component organization
GO:0048856	0.968	anatomical structure development
GO:0032501	0.945	multicellular organismal process
GO:0071704	0.934	organic substance metabolic process
GO:1902275	0.934	regulation of chromatin organization
GO:0044238	0.933	primary metabolic process
GO:0045595	0.928	regulation of cell differentiation
GO:0006807	0.918	nitrogen compound metabolic process
GO:0060322	0.912	head development
GO:0043170	0.905	macromolecule metabolic process
GO:0007275	0.898	multicellular organism development
GO:0048731	0.886	system development
GO:0019222	0.873	regulation of metabolic process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0007399	0.847	nervous system development
GO:0048513	0.827	animal organ development
GO:0007420	0.820	brain development
GO:0048518	0.778	positive regulation of biological process
GO:0044237	0.753	cellular metabolic process
GO:0010468	0.734	regulation of gene expression
GO:0048522	0.729	positive regulation of cellular process
GO:0036211	0.625	protein modification process
GO:0044260	0.594	cellular macromolecule metabolic process
GO:0031323	0.591	regulation of cellular metabolic process
GO:0080090	0.586	regulation of primary metabolic process
GO:0051171	0.585	regulation of nitrogen compound metabolic process
GO:0043414	0.572	macromolecule methylation
GO:0018193	0.543	peptidyl-amino acid modification
GO:0016570	0.487	histone modification
GO:0006479	0.486	protein methylation
GO:0018205	0.474	peptidyl-lysine modification
GO:0009893	0.437	positive regulation of metabolic process
GO:0010604	0.427	positive regulation of macromolecule metabolic process
GO:0019219	0.418	regulation of nucleobase-containing compound metabolic process
GO:0018022	0.393	peptidyl-lysine methylation
GO:0034968	0.377	histone lysine methylation
GO:0051568	0.309	histone H3-K4 methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	0.997	chromosome
GO:0035097	0.997	histone methyltransferase complex
GO:0000785	0.993	chromatin
GO:0048188	0.989	Set1C/COMPASS complex
GO:0005737	0.714	cytoplasm
GO:0016604	0.509	nuclear body
GO:0000791	0.415	euchromatin
GO:0016607	0.327	nuclear speck
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60260	1.000	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	1.000	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]