StarFunc result for job id O15050

User Input

>input (1400 residues)
MWDPRAARVPPRDLAVLLCNKSNAFFSLGKWNEAFVAAKECLQWDPTYVKGYYRAGYSLL
RLHQPYEAARMFFEGLRLVQRSQDQAPVADFLVGVFTTMSSDSIVLQSFLPCFDHIFTTG
FPTEVWQSVIEKLAKKGLWHSFLLLSAKKDRLPRNIHVPELSLKSLFEKYVFIGLYEKME
QVPKLVQWLISIGASVETIGPYPLHALMRLCIQARENHLFRWLMDHKPEWKGRINQKDGD
GCTVLHVVAAHSPGYLVKRQTEDVQMLLRFGADPTLLDRQSRSVVDVLKRNKNFKAIEKI
NSHLEKLATCSKDLSGFSNGDGPTSENDIFRKVLEQLVKYMNSGNRLLHKNFLKQEVVQR
FLRLLSTLQEIPPDLVCDINQDCATTVFKFLLEKQRWPEVLLLLTRKVSGEPPLGDCLIK
DCNFSDLDICTIIPHLSTWDQRKKQLLGCLIDSGALPDGLQESQERPVVTCLKHEDFELA
FLLLTKGADPRAISLTEGDTPLHAALHIFLEIKADIGFSFLSHLLDLFWSNPTEFDYLNP
NVQDSNGNTLMHILFQKGMLKRVKKLLDLLVKFDINFNLKNKEGKDARHRIKKNDSLLLA
WNKALMENRRRSRQDSAAHLGKLSKSTAPGHTSQLKSQGSFKSVPCGATARTLPEGSAVP
DSWETLPGTQVTRKEPGALRPCSLRDCLMQDITVLIQQVEVDPSFPEDCLQSSEPLEAGA
GKEGKKDDKPTLGAGAPDCSEVGEGHAQVGLGALQLVPDDNRGKEGNDDQDDWSTQEIEA
CLQDFDNMTWEIECTSEMLKKLSSKVMTKVIKKKIILAIQQLGNGEWTQGLQKRLKHLKG
SIQLFEAKLDKGARMLWELAIDFSPRCSENPEKIIATEQNTCAMEKSGRIYTEIIRIWDI
VLDHCKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEK
GREHVNPEYFPPASAVETEYNIMKFHSFSTNMAFNILNDTTATVEYPFRVGELEYAVIDL
NPRPLEPIILIGRSGTGKTTCCLYRLWKKFHVYWEKAEQAGSPLLAKQVWLKRRLEVEPG
KESPGGEEEEEEEDEEEEDSIEVETVESIDEQEYEACAGGAGVEPAGDGQAAEVCAPEHP
HQLEHLHQIFVTKNHVLCQEVQRNFIELSKSTKATSHYKPLDPNIHKLQDLRDENFPLFV
TSKQLLLLLDASLPKPFFLRNEDGSLKRTIIGWSAQEESTIPSWQEDEEEAEVDGDYSEE
DKAVEMRTGDSDPRVYVTFEVFKNEIWPKMTKGRTAYNPALIWKEIKSFLKGSFEALSCP
HGRLTEEVYKKLGRKRCPNFKEDRSEIYSLFSLYQQIRSQKGYFDEEDVLYNISRRLSKL
RVLPWSIHELYGDEIQDFTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:8cs9A	0.098	0.149	2.045E-8	796	0.078	0.137	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
2	AFDB:B5X0I6	0.100	0.121	2.703E-8	1091	0.084	0.107	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
3	AFDB:P0C0T2	0.083	0.125	1.298E-5	885	0.114	0.180	P0C0T2.pdb.gz	ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Anks6 PE=1 SV=2
4	PDB:7dkhI	0.097	0.128	2.852E-5	914	0.054	0.082	7dkhI.pdb.gz
5	AFDB:F4HRS2	0.076	0.057	6.142E-5	2222	0.084	0.053	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
6	PDB:5vkqA	0.092	0.088	6.343E-5	1499	0.057	0.053	5vkqA.pdb.gz
7	AFDB:Q8N2N9	0.098	0.101	2.038E-4	1353	0.091	0.094	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
8	PDB:4bujB	0.107	0.110	2.628E-4	1367	0.066	0.068	4bujB.pdb.gz
9	PDB:7dhgC	0.103	0.234	3.139E-4	470	0.059	0.177	7dhgC.pdb.gz
10	PDB:7qdrB	0.079	0.089	5.349E-4	1212	0.056	0.065	7qdrB.pdb.gz
11	PDB:7ntfA	0.099	0.139	6.982E-4	918	0.054	0.082	7ntfA.pdb.gz
12	PDB:4kvmB	0.084	0.120	7.631E-4	722	0.055	0.107	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
13	PDB:4oauC	0.084	0.157	9.114E-4	692	0.047	0.095	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6tedQ	0.088	0.119	1.244E-3	890	0.052	0.082	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	AFDB:O14607	0.103	0.106	1.316E-3	1347	0.056	0.059	O14607.pdb.gz	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
16	AFDB:Q12451	0.076	0.082	3.497E-3	1283	0.073	0.080	Q12451.pdb.gz	OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH2 PE=1 SV=1
17	AFDB:Q9T041	0.057	0.084	4.990E-3	864	0.082	0.133	Q9T041.pdb.gz	TOR1_ARATH Microtubule-associated protein TORTIFOLIA1 OS=Arabidopsis thaliana OX=3702 GN=TOR1 PE=1 SV=2
18	AFDB:Q5XJ13	0.058	0.095	5.453E-3	739	0.099	0.187	Q5XJ13.pdb.gz	ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio OX=7955 GN=anks6 PE=2 SV=1
19	AFDB:Q96KG9	0.080	0.121	6.513E-3	808	0.065	0.113	Q96KG9.pdb.gz	SCYL1_HUMAN N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1
20	AFDB:Q7Z333	0.077	0.052	1.016E-2	2677	0.102	0.053	Q7Z333.pdb.gz	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q553N9	1.07e-05	52.4	535	0.021	0.054	Q553N9_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275389 PE=4 SV=1
2	Q582T3	1.77e-05	51.2	348	0.016	0.063	Q582T3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.760 PE=4 SV=1
3	Q54F46	9.11e-05	49.7	803	0.027	0.047	WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum OX=44689 GN=warA PE=2 SV=1
4	Q54DA8	9.45e-05	49.3	564	0.019	0.046	STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum OX=44689 GN=sti1 PE=3 SV=1
5	O70511	3.10e-04	48.1	2622	0.030	0.016	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
6	G5E8K5	6.38e-04	47.0	1961	0.030	0.021	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
7	O88521	8.77e-04	46.6	1762	0.030	0.024	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
8	Q12955	0.001	46.6	4377	0.029	0.009	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
9	Q57ZX0	0.001	45.4	550	0.014	0.035	Q57ZX0_TRYB2 Stress-induced protein sti1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.210 PE=4 SV=1
10	Q5XEP2	0.001	45.4	571	0.017	0.042	HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
11	Q8ILC1	0.002	44.7	564	0.017	0.043	HSOP_PLAF7 Hsp70-Hsp90 organising protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=HOP PE=1 SV=1
12	Q95TD6	0.002	44.3	298	0.018	0.084	Q95TD6_DROME SD07783p OS=Drosophila melanogaster OX=7227 GN=adp PE=2 SV=1
13	Q7K7W5	0.004	43.9	628	0.018	0.040	Q7K7W5_DROME Adipose protein OS=Drosophila melanogaster OX=7227 GN=adp PE=2 SV=1
14	Q9VJ14	0.005	43.9	1049	0.031	0.042	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
15	O14085	0.009	41.2	192	0.017	0.125	SEC72_SCHPO Translocation protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=3 SV=1
16	P15705	0.009	42.7	589	0.016	0.039	STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STI1 PE=1 SV=1
17	Q6FRI9	0.009	42.7	583	0.017	0.041	Q6FRI9_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08195g PE=4 SV=1
18	Q6TGV5	0.010	41.6	226	0.029	0.181	Q6TGV5_DANRE 26S proteasome non-ATPase regulatory subunit 10 OS=Danio rerio OX=7955 GN=PSMD10 PE=1 SV=1
19	O43765	0.012	42.0	313	0.015	0.067	SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1
20	Q385S7	0.015	42.0	392	0.015	0.054	Q385S7_TRYB2 Ankyrin repeat protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2520 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	4.1e+02	12.6	AAA domain
2	PF00023 Ank	0.27	22.9	Ankyrin repeat
3	PF12796 Ank_2	4.6e-06	38.4	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	1.6	20.4	Ankyrin repeat
5	PF13637 Ank_4	0.00052	31.8	Ankyrin repeats (many copies)
6	PF13857 Ank_5	15	17.3	Ankyrin repeats (many copies)
7	PF00515 TPR_1	77	14.5	Tetratricopeptide repeat
8	PF13414 TPR_11	57	14.8	TPR repeat
9	PF07719 TPR_2	3	19.2	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278550	0.669	Teneurin-4
2	9606.ENSP00000386660	0.597	Lysine-specific demethylase 3A
3	9606.ENSP00000444596	0.587	E3 ubiquitin-protein ligase MYCBP2
4	9606.ENSP00000384192	0.579	Ras guanyl-releasing protein 3
5	9606.ENSP00000357459	0.574	Double-stranded RNA-specific adenosine deaminase
6	9606.ENSP00000280772	0.570	Ankyrin-3
7	9606.ENSP00000366280	0.568	VIP36-like protein
8	9606.ENSP00000385334	0.561	Mitotic spindle assembly checkpoint protein MAD1
9	9606.ENSP00000379412	0.544	Zinc finger NFX1-type containing 1
10	9606.ENSP00000257118	0.527	Polyhomeotic-like protein 2
11	9606.ENSP00000275767	0.524	Transmembrane protein 140
12	9606.ENSP00000318374	0.510	Leukocyte receptor cluster member 8
13	9606.ENSP00000322832	0.506	Protein rogdi homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.926	biological regulation
GO:0050794	0.918	regulation of cellular process
GO:0009987	0.876	cellular process
GO:0071704	0.737	organic substance metabolic process
GO:0019222	0.562	regulation of metabolic process
GO:0060255	0.554	regulation of macromolecule metabolic process
GO:0080090	0.432	regulation of primary metabolic process
GO:0051171	0.367	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005634	0.959	nucleus
GO:0005737	0.860	cytoplasm
GO:0043233	0.695	organelle lumen
GO:0070013	0.694	intracellular organelle lumen
GO:0031981	0.612	nuclear lumen
GO:0043228	0.423	non-membrane-bounded organelle
GO:0043232	0.407	intracellular non-membrane-bounded organelle
GO:0016020	0.380	membrane
GO:0032991	0.333	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]