StarFunc result for job id O15054

User Input

>input (1643 residues)
MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPL
PPSHGSSSGHPSKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE
HDSEEATRCYHSALRYGGSFAELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLL
HLEHKRNYGAKRGGPPVKRAAEPPVVQPVPPAALSGPSGEEGLSPGGKRRRGCNSEQTGL
PPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPGLWSTLHGDAWGPERKGSAPP
ERQEQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCLPATRPPGSDL
RESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGIP
GADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPP
PPPAWLKGPACRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDS
HTPPTPPTPTTSSSNSNSGSHSSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLV
PLTLALPPAPPSSCHQNTSGSFRRPESPRPRVSFPKTPEVGPGPPPGPLSKAPQPVPPGV
GELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQHEAGVA
PQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKKPPPALPPPPP
LAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG
PPSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPP
PLSLPPARSESEVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKE
EAGGVAAVSGSCKRRQKEHQKEHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGN
LDLQSEEIQGREKSRPDLGGASKAKPPTAPAPPSAPAPSAQPTPPSASVPGKKAREEAPG
PPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAA
DVVRASRNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPV
LLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT
GTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDP
KNHHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYM
KVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPI
LDDLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERY
EWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKK
IAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLE
QYRTEELAQAYDAFTLAPASTSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15054	1.000	1.000	0.000	1643	1.000	1.000	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
2	AFDB:A0A1D5NSI1	0.346	0.287	9.003E-97	1996	0.422	0.347	A0A1D5NSI1.pdb.gz
3	AFDB:E9QG91	0.334	0.319	2.507E-94	1719	0.361	0.345	E9QG91.pdb.gz
4	AFDB:Q9VT00	0.197	0.141	3.275E-16	2351	0.168	0.117	Q9VT00.pdb.gz	Q9VT00_DROME Jumonji, AT rich interactive domain 2 OS=Drosophila melanogaster OX=7227 GN=Jarid2 PE=1 SV=3
5	PDB:4b7eA	0.132	0.511	3.255E-9	349	0.037	0.175	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
6	PDB:3al5B	0.121	0.549	3.616E-9	311	0.022	0.116	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
7	PDB:7yxgA	0.119	0.510	4.463E-9	313	0.028	0.147	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
8	PDB:4qszA	0.121	0.260	8.390E-9	686	0.030	0.073	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
9	PDB:5nfnB	0.123	0.509	8.390E-9	318	0.029	0.148	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
10	AFDB:Q7LBC6	0.153	0.143	3.806E-8	1761	0.117	0.110	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
11	PDB:3al5C	0.118	0.556	1.995E-6	284	0.025	0.144	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	AFDB:A0A0R4IYD2	0.137	0.091	1.005E-5	2557	0.153	0.099	A0A0R4IYD2.pdb.gz
13	PDB:4cclB	0.082	0.303	1.258E-5	372	0.021	0.091	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
14	PDB:4bu2A	0.055	0.211	2.394E-4	379	0.013	0.055	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
15	PDB:4bxfA	0.110	0.355	2.803E-4	425	0.027	0.104	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
16	PDB:1ipkC	0.044	0.188	3.152E-3	379	0.011	0.047	1ipkC.pdb.gz
17	AFDB:A0A1D8PRW9	0.049	0.059	9.387E-3	1172	0.086	0.120	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1
18	AFDB:Q9VUB7	0.043	0.036	1.221E-2	2294	0.096	0.068	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
19	AFDB:Q14207	0.041	0.045	1.357E-2	1427	0.116	0.134	Q14207.pdb.gz	NPAT_HUMAN Protein NPAT OS=Homo sapiens OX=9606 GN=NPAT PE=1 SV=3
20	AFDB:Q9VRY4	0.032	0.029	1.961E-2	1833	0.110	0.098	Q9VRY4.pdb.gz	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6D0	667	1316	0.187	0.233	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
2	A0A8I5ZM74	736	1400	0.201	0.236	A0A8I5ZM74_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
3	A0A8I5ZTM6	695	1208	0.186	0.252	A0A8I5ZTM6_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
4	A0A8I5ZXR3	736	1418	0.201	0.233	A0A8I5ZXR3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
5	A0A8I6A5T3	736	1452	0.201	0.228	A0A8I6A5T3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
6	A0A8I6ADI5	735	1321	0.201	0.251	A0A8I6ADI5_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
7	A0A8I6AFH2	2447	1635	0.908	0.913	A0A8I6AFH2_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=1
8	A0A8I6G9K0	699	1150	0.187	0.268	A0A8I6G9K0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
9	A0A8I6GMA3	735	1373	0.201	0.241	A0A8I6GMA3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
10	A0A8I6GMK8	700	1214	0.187	0.254	A0A8I6GMK8_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
11	A1L1S9	673	1311	0.191	0.240	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
12	C9WPN3	596	1134	0.160	0.232	C9WPN3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Uty PE=2 SV=1
13	F1Q597	729	1452	0.203	0.230	F1Q597_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=kdm6a PE=1 SV=2
14	G3V9U4	2338	1569	0.864	0.905	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
15	M9MRG4	623	1130	0.172	0.250	M9MRG4_DROME Utx histone demethylase, isoform D OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
16	M9PCJ7	624	934	0.172	0.302	M9PCJ7_DROME Utx histone demethylase, isoform E OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
17	O14607	721	1347	0.193	0.235	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
18	O15054	3280	1643	1.000	1.000	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
19	O15550	741	1401	0.203	0.238	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
20	O70546	744	1401	0.204	0.239	KDM6A_MOUSE Lysine-specific demethylase 6A OS=Mus musculus OX=10090 GN=Kdm6a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02373 JmjC	2.6e-27	106.9	JmjC domain, hydroxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000177694	0.971	T-box transcription factor TBX21
2	9606.ENSP00000264515	0.960	Retinoblastoma-binding protein 5
3	9606.ENSP00000269305	0.960	Cellular tumor antigen p53
4	9606.ENSP00000340896	0.954	Set1/Ash2 histone methyltransferase complex subunit ASH2
5	9606.ENSP00000332194	0.951	Histone H2A type 2-C
6	9606.ENSP00000296417	0.945	Histone H2A.Z
7	9606.ENSP00000358151	0.937	Histone H2B type 2-E
8	9606.ENSP00000308405	0.934	Histone H2A.V
9	9606.ENSP00000301067	0.928	Histone-lysine N-methyltransferase 2D
10	9606.ENSP00000351446	0.924	WD repeat-containing protein 5
11	9606.ENSP00000434024	0.924	Histone H2AX
12	9606.ENSP00000360266	0.923	Transcription factor AP-1
13	9606.ENSP00000367022	0.922	Histone H2A type 1-C
14	9606.ENSP00000484261	0.922	Histone H2A-Bbd type 1
15	9606.ENSP00000306245	0.921	Proto-oncogene c-Fos
16	9606.ENSP00000262160	0.919	Mothers against decapentaplegic homolog 2
17	9606.ENSP00000395654	0.918	Transcription activator BRG1
18	9606.ENSP00000438553	0.917	Histone H2A.J
19	9606.ENSP00000328484	0.915	Histone H2A type 1-J
20	9606.ENSP00000341094	0.915	Histone H2A type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0071558	0.995	histone H3K27me2/H3K27me3 demethylase activity
GO:0003682	0.582	chromatin binding
GO:0097159	0.393	organic cyclic compound binding
GO:1901363	0.390	heterocyclic compound binding
GO:0003676	0.382	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.972	response to stimulus
GO:0032502	0.972	developmental process
GO:0048856	0.959	anatomical structure development
GO:0032501	0.955	multicellular organismal process
GO:0048513	0.932	animal organ development
GO:0009987	0.917	cellular process
GO:0007275	0.916	multicellular organism development
GO:0065007	0.858	biological regulation
GO:0006950	0.849	response to stress
GO:0048731	0.849	system development
GO:0050789	0.826	regulation of biological process
GO:0042221	0.771	response to chemical
GO:0050794	0.761	regulation of cellular process
GO:0008152	0.747	metabolic process
GO:0071704	0.675	organic substance metabolic process
GO:0019222	0.668	regulation of metabolic process
GO:0044238	0.643	primary metabolic process
GO:0060255	0.599	regulation of macromolecule metabolic process
GO:0006807	0.573	nitrogen compound metabolic process
GO:0051171	0.501	regulation of nitrogen compound metabolic process
GO:0031323	0.499	regulation of cellular metabolic process
GO:0080090	0.498	regulation of primary metabolic process
GO:0048518	0.470	positive regulation of biological process
GO:0010468	0.468	regulation of gene expression
GO:0043170	0.439	macromolecule metabolic process
GO:1901564	0.399	organonitrogen compound metabolic process
GO:0019538	0.376	protein metabolic process
GO:0019219	0.366	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.354	positive regulation of metabolic process
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:2001141	0.328	regulation of RNA biosynthetic process
GO:0048522	0.327	positive regulation of cellular process
GO:0002376	0.322	immune system process
GO:0006355	0.317	regulation of DNA-templated transcription
GO:0048519	0.300	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.788	cytoplasm
GO:0032991	0.449	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60224	0.995	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate
EC:1.14.11.68	0.995	[histone H3]-trimethyl-L-lysine(27) demethylase.

[back to server]