StarFunc result for job id O15055

User Input

>input (1255 residues)
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKS
VTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKA
ESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLAGPALACGLSQEKEPF
KKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRN
TSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPC
ACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGA
DCKPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSG
SLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLM
ADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLP
AAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15055	1.000	1.000	0.000	1255	1.000	1.000	O15055.pdb.gz	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
2	AFDB:O54943	0.484	0.483	0.000	1257	0.790	0.789	O54943.pdb.gz	PER2_MOUSE Period circadian protein homolog 2 OS=Mus musculus OX=10090 GN=Per2 PE=1 SV=3
3	AFDB:Q8QGQ8	0.389	0.369	0.000	1344	0.607	0.567	Q8QGQ8.pdb.gz	PER2_CHICK Period circadian protein homolog 2 OS=Gallus gallus OX=9031 GN=PER2 PE=2 SV=1
4	AFDB:F1QUT1	0.342	0.310	2.714E-95	1399	0.515	0.462	F1QUT1.pdb.gz	F1QUT1_DANRE Period circadian clock 2 OS=Danio rerio OX=7955 GN=fj43b09 PE=4 SV=3
5	AFDB:B3DK47	0.410	0.373	4.519E-84	1398	0.432	0.388	B3DK47.pdb.gz
6	AFDB:A0A0R4ICG0	0.317	0.289	7.467E-84	1387	0.434	0.393	A0A0R4ICG0.pdb.gz	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
7	AFDB:Q8CHI5	0.404	0.394	8.828E-84	1293	0.447	0.434	Q8CHI5.pdb.gz	PER1_RAT Period circadian protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Per1 PE=1 SV=2
8	AFDB:Q7SZZ4	0.278	0.283	3.461E-81	1229	0.409	0.417	Q7SZZ4.pdb.gz	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
9	AFDB:J3KRL7	0.268	0.266	1.624E-75	1267	0.433	0.429	J3KRL7.pdb.gz	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
10	AFDB:F1RDZ4	0.344	0.339	5.933E-72	1281	0.393	0.385	F1RDZ4.pdb.gz
11	PDB:7rzwB	0.076	0.109	5.725E-4	864	0.035	0.051	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
12	PDB:2wkpA	0.077	0.280	8.001E-4	320	0.011	0.044	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:6umzA	0.070	0.577	1.058E-3	127	0.010	0.102	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
14	PDB:6jt0B	0.066	0.134	3.054E-3	576	0.028	0.061	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:6jp8F	0.058	0.071	4.268E-3	973	0.013	0.016	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
16	PDB:7jsnA	0.045	0.065	3.979E-2	820	0.029	0.044	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
17	PDB:3tgoD	0.033	0.146	1.518E-1	186	0.010	0.065	3tgoD.pdb.gz
18	PDB:4v6wAD	0.040	0.135	2.509E-1	227	0.018	0.101	4v6wAD.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:4pn1B	0.043	0.130	3.317E-1	261	0.020	0.096	4pn1B.pdb.gz	Fission yeast RNA triphosphatase reads an Spt5 CTD code.
20	PDB:6snoA	0.033	0.064	3.317E-1	573	0.010	0.023	6snoA.pdb.gz	Structural basis for substrate and product recognition in human phosphoglucomutase-1 (PGM1) isoform 2, a member of the alpha-D-phosphohexomutase superfamily.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ICG0	0.0	808	1387	0.427	0.386	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
2	F1QUT1	0.0	1039	1399	0.515	0.462	F1QUT1_DANRE Period circadian clock 2 OS=Danio rerio OX=7955 GN=fj43b09 PE=4 SV=3
3	O15055	0.0	2588	1255	1.000	1.000	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
4	O35973	0.0	665	1291	0.300	0.292	PER1_MOUSE Period circadian protein homolog 1 OS=Mus musculus OX=10090 GN=Per1 PE=1 SV=2
5	O54943	0.0	1899	1257	0.787	0.786	PER2_MOUSE Period circadian protein homolog 2 OS=Mus musculus OX=10090 GN=Per2 PE=1 SV=3
6	Q5BJ30	0.0	667	1185	0.300	0.318	Q5BJ30_MOUSE Per1 protein OS=Mus musculus OX=10090 GN=Per1 PE=2 SV=1
7	Q6E2N4	0.0	775	1398	0.429	0.385	Q6E2N4_DANRE Period 1-like protein OS=Danio rerio OX=7955 GN=per4 PE=2 SV=1
8	Q7SZZ4	0.0	778	1229	0.407	0.416	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
9	Q8CHI5	0.0	657	1293	0.300	0.292	PER1_RAT Period circadian protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Per1 PE=1 SV=2
10	Q8QGQ8	0.0	1346	1344	0.609	0.568	PER2_CHICK Period circadian protein homolog 2 OS=Gallus gallus OX=9031 GN=PER2 PE=2 SV=1
11	Q9I8L4	0.0	661	1281	0.386	0.379	Q9I8L4_DANRE Period circadian protein homolog 3 OS=Danio rerio OX=7955 GN=Per3 PE=2 SV=1
12	Q9Z301	0.0	1890	1257	0.783	0.782	PER2_RAT Period circadian protein homolog 2 OS=Rattus norvegicus OX=10116 GN=Per2 PE=1 SV=1
13	J3QSH9	4.41e-176	534	572	0.214	0.469	J3QSH9_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
14	P56645	5.99e-175	552	1201	0.352	0.368	PER3_HUMAN Period circadian protein homolog 3 OS=Homo sapiens OX=9606 GN=PER3 PE=1 SV=4
15	O70361	1.73e-142	463	1113	0.291	0.328	PER3_MOUSE Period circadian protein homolog 3 OS=Mus musculus OX=10090 GN=Per3 PE=1 SV=2
16	Q6IN51	1.23e-61	214	294	0.093	0.398	Q6IN51_HUMAN PER1 protein OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
17	J3KRL7	2.41e-34	145	1267	0.061	0.060	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
18	O15534	2.53e-34	145	1290	0.061	0.059	PER1_HUMAN Period circadian protein homolog 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=2
19	P07663	1.26e-27	124	1224	0.065	0.067	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
20	A0A0R4IH97	2.83e-23	108	631	0.073	0.144	A0A0R4IH97_DANRE Aryl hydrocarbon receptor nuclear translocator-like 2 OS=Danio rerio OX=7955 GN=bmal2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00989 PAS	0.00045	31.6	PAS fold
2	PF14598 PAS_11	0.00057	31.3	PAS domain
3	PF08447 PAS_3	1.3e-08	46.3	PAS fold
4	PF12114 Period_C	2.2e-72	254.1	Period protein 2/3C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000008527	0.999	Cryptochrome-1
2	9606.ENSP00000380044	0.999	Casein kinase I isoform epsilon
3	9606.ENSP00000478187	0.999	Cryptochrome-2
4	9606.ENSP00000308741	0.997	Circadian locomoter output cycles protein kaput
5	9606.ENSP00000324464	0.997	Casein kinase I isoform delta
6	9606.ENSP00000384517	0.996	Aryl hydrocarbon receptor nuclear translocator-like protein 1
7	9606.ENSP00000242728	0.995	Class E basic helix-loop-helix protein 41
8	9606.ENSP00000297689	0.986	Nuclear factor interleukin-3-regulated protein
9	9606.ENSP00000314420	0.984	Period circadian protein homolog 1
10	9606.ENSP00000359206	0.975	F-box/WD repeat-containing protein 1A
11	9606.ENSP00000482093	0.969	Period circadian protein homolog 3
12	9606.ENSP00000276079	0.951	Non-POU domain-containing octamer-binding protein
13	9606.ENSP00000246672	0.945	Nuclear receptor subfamily 1 group D member 1
14	9606.ENSP00000450607	0.944	Protein timeless homolog
15	9606.ENSP00000351446	0.943	WD repeat-containing protein 5
16	9606.ENSP00000231509	0.941	Glucocorticoid receptor
17	9606.ENSP00000437955	0.940	Hypoxia-inducible factor 1-alpha
18	9606.ENSP00000338283	0.937	Neuronal PAS domain-containing protein 2
19	9606.ENSP00000231487	0.930	S-phase kinase-associated protein 1
20	9606.ENSP00000326804	0.915	Cullin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.767	heterocyclic compound binding
GO:0097159	0.767	organic cyclic compound binding
GO:0003676	0.748	nucleic acid binding
GO:0019899	0.642	enzyme binding
GO:0003690	0.541	double-stranded DNA binding
GO:0043565	0.441	sequence-specific DNA binding
GO:1990837	0.402	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.969	regulation of biological process
GO:0019222	0.936	regulation of metabolic process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0048511	0.918	rhythmic process
GO:0007623	0.850	circadian rhythm
GO:0050794	0.828	regulation of cellular process
GO:0010468	0.822	regulation of gene expression
GO:0080090	0.722	regulation of primary metabolic process
GO:0051171	0.688	regulation of nitrogen compound metabolic process
GO:0031323	0.619	regulation of cellular metabolic process
GO:0050896	0.611	response to stimulus
GO:0019219	0.575	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.573	regulation of cellular biosynthetic process
GO:0010556	0.567	regulation of macromolecule biosynthetic process
GO:0051252	0.548	regulation of RNA metabolic process
GO:0006355	0.538	regulation of DNA-templated transcription
GO:0048519	0.497	negative regulation of biological process
GO:0009987	0.487	cellular process
GO:0048518	0.442	positive regulation of biological process
GO:0048523	0.415	negative regulation of cellular process
GO:0009892	0.362	negative regulation of metabolic process
GO:0006357	0.355	regulation of transcription by RNA polymerase II
GO:0010605	0.353	negative regulation of macromolecule metabolic process
GO:0031324	0.353	negative regulation of cellular metabolic process
GO:0008152	0.330	metabolic process
GO:0051172	0.320	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]