StarFunc result for job id O15062

User Input

>input (677 residues)
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLD
QRTPFPMRRLHKRKQSAEERARQRLRPSIDESAISDVTPENGPSGVHSREEFFSPDSLKI
VDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSAGNMAQLSMASRATQVETSFD
QEAAPEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEG
VVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNN
FTANQNNDDNIPNTTSDCRLESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVR
PMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAP
KMPVVTSVRSSQIPENSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALS
EHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15062	1.000	1.000	5.234E-94	677	1.000	1.000	O15062.pdb.gz	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
2	AFDB:Q9ULJ3	0.159	0.102	7.091E-13	1066	0.179	0.114	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
3	AFDB:Q7KQZ4	0.184	0.160	4.153E-10	787	0.167	0.144	Q7KQZ4.pdb.gz	LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
4	AFDB:Q24206	0.153	0.118	1.316E-9	880	0.177	0.136	Q24206.pdb.gz	BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster OX=7227 GN=br PE=1 SV=2
5	AFDB:Q9BYV9	0.175	0.142	9.751E-9	841	0.148	0.119	Q9BYV9.pdb.gz	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
6	AFDB:Q9V5M3	0.160	0.125	3.089E-8	878	0.186	0.144	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
7	PDB:6wcqC	0.166	0.816	3.726E-8	130	0.055	0.285	6wcqC.pdb.gz
8	AFDB:A0A0A6YY25	0.161	0.151	2.154E-7	723	0.165	0.155	A0A0A6YY25.pdb.gz	BTBDI_MOUSE BTB/POZ domain-containing protein 18 OS=Mus musculus OX=10090 GN=Btbd18 PE=1 SV=1
9	AFDB:Q9V5M6	0.159	0.115	2.432E-7	963	0.219	0.154	Q9V5M6.pdb.gz	LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=4
10	AFDB:B2RXH4	0.161	0.153	3.501E-7	712	0.158	0.150	B2RXH4.pdb.gz	BTBDI_HUMAN BTB/POZ domain-containing protein 18 OS=Homo sapiens OX=9606 GN=BTBD18 PE=1 SV=1
11	AFDB:M9NEG1	0.184	0.116	9.246E-7	1109	0.139	0.085	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
12	PDB:7mk2A	0.149	0.275	8.326E-4	354	0.032	0.062	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:2p1nD	0.128	0.577	4.858E-2	127	0.025	0.134	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:6sgaFS	0.106	0.242	1.069E-1	277	0.031	0.076	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
15	PDB:3ogkA	0.131	0.547	1.539E-1	145	0.025	0.117	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
16	PDB:5vztA	0.138	0.558	1.738E-1	145	0.025	0.117	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
17	PDB:7pquA	0.086	0.169	2.354E-1	328	0.022	0.046	7pquA.pdb.gz
18	PDB:3w5kB	0.054	0.234	2.658E-1	110	0.031	0.191	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
19	PDB:7f3fA	0.106	0.149	4.319E-1	460	0.027	0.039	7f3fA.pdb.gz
20	PDB:7phhA	0.108	0.178	5.182E-1	396	0.024	0.040	7phhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15062	0.0	1405	677	1.000	1.000	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
2	Q9H5J0	2.84e-28	122	574	0.086	0.101	ZBTB3_HUMAN Zinc finger and BTB domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBTB3 PE=1 SV=1
3	B2RXF5	2.11e-23	105	422	0.080	0.128	ZBT42_HUMAN Zinc finger and BTB domain-containing protein 42 OS=Homo sapiens OX=9606 GN=ZBTB42 PE=1 SV=2
4	Q811H0	7.06e-23	103	420	0.087	0.140	ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus OX=10090 GN=Zbtb42 PE=1 SV=2
5	Q13105	4.76e-22	103	803	0.102	0.086	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
6	Q99592	8.30e-22	102	522	0.072	0.094	ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZBTB18 PE=1 SV=1
7	Q9QZ48	8.63e-22	102	569	0.078	0.093	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
8	Q9WUK6	8.68e-22	101	522	0.072	0.094	ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus OX=10090 GN=Zbtb18 PE=1 SV=1
9	O95365	2.26e-21	100	584	0.078	0.091	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
10	O88939	2.78e-21	100	569	0.078	0.093	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
11	Q60821	6.83e-21	100	794	0.083	0.071	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
12	Q86UZ6	1.43e-20	98.6	589	0.068	0.078	ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2
13	Q8BID6	2.35e-20	97.8	600	0.068	0.077	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
14	Q99MD8	2.22e-18	91.7	610	0.075	0.084	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
15	Q9NPC7	3.41e-18	90.9	610	0.075	0.084	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
16	Q8NAP8	7.62e-18	89.4	495	0.068	0.093	ZBT8B_HUMAN Zinc finger and BTB domain-containing protein 8B OS=Homo sapiens OX=9606 GN=ZBTB8B PE=1 SV=2
17	Q8VCZ7	1.99e-17	88.6	619	0.066	0.073	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
18	A1YPR0	9.65e-17	86.7	619	0.065	0.071	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
19	Q96DT7	1.07e-16	86.7	871	0.061	0.047	ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 PE=1 SV=2
20	P41183	1.74e-16	85.9	707	0.071	0.068	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02177 APP_N	2e+02	13.7	Amyloid A4 N-terminal heparin-binding
2	PF00651 BTB	1.6e-25	100.9	BTB/POZ domain
3	PF06419 COG6	1.2e+02	12.3	Conserved oligomeric complex COG6
4	PF02509 Rota_NS35	4e+02	11.4	Rotavirus non-structural protein 35
5	PF11822 SANBR_BTB	61	15.2	SANT and BTB domain regulator of CSR, BTB domain
6	PF00096 zf-C2H2	22	16.9	Zinc finger, C2H2 type
7	PF18868 zf-C2H2_3rep	78	15.4	Zinc finger C2H2-type, 3 repeats
8	PF13894 zf-C2H2_4	14	17.8	C2H2-type zinc finger
9	PF13465 zf-H2C2_2	0.00084	30.9	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432487	0.659	Protein SAAL1
2	9606.ENSP00000436424	0.604	Olfactory receptor 4D10
3	9606.ENSP00000367658	0.588	Actin related protein T2
4	9606.ENSP00000376930	0.556	Endoplasmic reticulum membrane protein that promotes endoplasmic reticulum-associated endosome fission . Localizes to contact sites between the endoplasmic reticulum and endosomes and acts by promoting recruitment of the endoplasmic reticulum to endosome tubules for fission . Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane .
5	9606.ENSP00000267984	0.527	Talin rod domain-containing protein 1
6	9606.ENSP00000356057	0.526	Transmembrane protein 181
7	9606.ENSP00000392368	0.518	Uncharacterized protein CCDC198

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0010556	0.988	regulation of macromolecule biosynthetic process
GO:1903506	0.983	regulation of nucleic acid-templated transcription
GO:0010468	0.950	regulation of gene expression
GO:0006355	0.934	regulation of DNA-templated transcription
GO:0045892	0.898	negative regulation of DNA-templated transcription
GO:0000122	0.730	negative regulation of transcription by RNA polymerase II
GO:0009987	0.618	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.877	intracellular organelle lumen
GO:0031981	0.863	nuclear lumen
GO:0005737	0.690	cytoplasm
GO:0005654	0.468	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]