StarFunc result for job id O15063

User Input

>input (1070 residues)
MYCCSAQDSKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTATTAPLGSLTAA
GSCHHAMPHTTPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAATQLKDV
QEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSLQDIEVLGRCFLTVVQVHFQ
FLTHALQKVQPVAHSCFAEVIVPEKKNSGSGGGLSGMGHTPEVEEAVRSWRGAAEATSRL
RERGCDGCLAGIEVQQLFCSQSAAIPEHQLKELNIKIDSALQAYKIALESLGHCEYAMKA
GFHLNPKAIEASLQGCCSEAEAQQTGRRQTPPQPMQCELPTVPVQIGSHFLKGVSFNESA
ADNLKLKTHTMLQLMKEAGCYNGITSRDDFPVTEVLNQVCPSTWRGACKTAVQLLFGQAG
LVVVDTAQIENKEAYAPQISLEGSRIVVQVPSTWCLKEDPATMSLLQRSLDPEKTLGLVD
VLYTAVLDLNRWRAGREQALPCIQIQLQREICDFGNQADLPSGNGNKSSGGLQKTFSKLT
SRFTKKASCTSSSSSTNYSIQNTPSKNIFIAGCSEEKAKMPGNIDTRLQSILNIGNFPRT
TDPSQSAQNSSNTVANGFLMERRENFLHGDDGKDEKGMNLPTDQEMQEVIDFLSGFNMGQ
SHQGSPLVTRHNSAATAMVTEQKAGAMQPQQPSLPVPPPPRAPQAGAHTPLTPQPGLAPQ
QQSPKQQQPQVQYYQHLLQPIGPQQPPPQPRAPGKWVHGSSQQPAQAVGAGLSPLGQWPG
ISDLSSDLYSLGLVSSYMDNVMSEVLGQKPQGPRNNTWPNRDQSDGVFGMLGEILPFDPA
VGSDPEFARYVAGVSQAMQQKRQAQHGRRPGNPRGNWPPMDDAHRTWPFPEFFTEGDGLH
GGWSGAQGDSASSSDETSSANGDSLFSMFSGPDLVAAVKQRRKHSSGEQDTSTLPSPPLL
TTVEDVNQDNKTKTWPPKAPWQHPSPLPSTLPSPSAPLYAVTSPGSQWNDTMQMLQSPVW
AATNDCSAAAFSYVQTPPQPPPPPAHKAAPKGFKAFPGKGERRPAYLPQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15063	1.000	1.000	0.000	1070	1.000	1.000	O15063.pdb.gz	GRRE1_HUMAN Granule associated Rac and RHOG effector protein 1 OS=Homo sapiens OX=9606 GN=GARRE1 PE=1 SV=2
2	AFDB:Q6A070	0.060	0.047	6.779E-4	1776	0.143	0.086	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
3	AFDB:Q9H7P9	0.068	0.058	1.401E-2	1386	0.130	0.100	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
4	AFDB:Q17602	0.087	0.072	1.552E-2	1390	0.120	0.092	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
5	AFDB:Q6F5E8	0.051	0.040	4.562E-2	1435	0.116	0.086	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
6	PDB:1yvlB	0.051	0.071	8.410E-2	653	0.050	0.081	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
7	AFDB:Q389X2	0.057	0.052	8.891E-2	1221	0.134	0.117	Q389X2.pdb.gz	Q389X2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0240 PE=4 SV=1
8	AFDB:P16382	0.039	0.048	1.341E-1	810	0.092	0.121	P16382.pdb.gz	IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il4r PE=1 SV=1
9	AFDB:Q0VF58	0.045	0.044	1.564E-1	1136	0.091	0.085	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
10	AFDB:E9Q793	0.044	0.057	1.733E-1	770	0.075	0.104	E9Q793.pdb.gz	JHY_MOUSE Jhy protein OS=Mus musculus OX=10090 GN=Jhy PE=1 SV=1
11	AFDB:Q9VW83	0.066	0.048	1.920E-1	1847	0.127	0.074	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
12	PDB:7m5xA	0.032	0.034	3.726E-1	1000	0.038	0.041	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
13	PDB:7n6g6A	0.065	0.046	5.915E-1	1558	0.055	0.038	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:1y8pA	0.059	0.109	6.554E-1	381	0.045	0.126	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
15	PDB:6rkoA	0.058	0.130	6.554E-1	444	0.043	0.104	6rkoA.pdb.gz	Active site rearrangement and structural divergence in prokaryotic respiratory oxidases.
16	PDB:7odrd	0.065	0.153	6.554E-1	259	0.024	0.100	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
17	PDB:7pubCI	0.036	0.076	6.554E-1	427	0.037	0.094	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:6rx4B	0.039	0.089	7.645E-1	379	0.022	0.063	6rx4B.pdb.gz	Homologous bd oxidases share the same architecture but differ in mechanism.
19	PDB:5nzrK	0.042	0.063	8.048E-1	560	0.054	0.104	5nzrK.pdb.gz
20	PDB:3w1zB	0.036	0.185	8.918E-1	143	0.007	0.049	3w1zB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15063	0.0	2215	1070	1.000	1.000	GRRE1_HUMAN Granule associated Rac and RHOG effector protein 1 OS=Homo sapiens OX=9606 GN=GARRE1 PE=1 SV=2
2	A1A512	9.40e-136	409	206	0.184	0.956	A1A512_HUMAN KIAA0355 protein OS=Homo sapiens OX=9606 GN=KIAA0355 PE=1 SV=1
3	Q708S4	0.16	38.1	539	0.020	0.039	ASI4A_DANRE Acid-sensing ion channel 4-A OS=Danio rerio OX=7955 GN=asic4a PE=2 SV=1
4	A0A060DAJ9	0.21	38.1	537	0.021	0.043	A0A060DAJ9_ONCMY Acid-sensing ion channel 4 OS=Oncorhynchus mykiss OX=8022 GN=ASIC4 PE=2 SV=1
5	Q708S3	0.54	36.6	558	0.021	0.039	ASI4B_DANRE Acid-sensing ion channel 4-B OS=Danio rerio OX=7955 GN=asic4b PE=2 SV=1
6	Q7TNS7	0.87	35.8	539	0.021	0.043	ASIC4_MOUSE Acid-sensing ion channel 4 OS=Mus musculus OX=10090 GN=Asic4 PE=2 SV=1
7	Q96FT7	1.1	35.8	539	0.021	0.043	ASIC4_HUMAN Acid-sensing ion channel 4 OS=Homo sapiens OX=9606 GN=ASIC4 PE=1 SV=3
8	Q57VV6	1.6	35.4	2127	0.028	0.014	Q57VV6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.790 PE=4 SV=1
9	Q8SX08	1.9	34.7	320	0.032	0.106	Q8SX08_DROME CDK-activating kinase assembly factor MAT1 OS=Drosophila melanogaster OX=7227 GN=Mat1 PE=2 SV=1
10	A8DYP0	7.1	33.1	4218	0.025	0.006	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15923 DUF4745	5.6e-48	173.7	Domain of unknown function (DUF4745)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384197	0.612	PDZ domain containing ring finger 4
2	9606.ENSP00000252992	0.530	Centrosomal protein of 85 kDa
3	9606.ENSP00000282003	0.526	E3 ubiquitin ligase essential for DNA replication origin activation during S phase . Acts as a replication origin selector which selects the origins to be fired and catalyzes the multi-mono-ubiquitination of a subset of chromatin-bound ORC3 and ORC5 during S-phase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1905762	1.000	CCR4-NOT complex binding
GO:0031267	1.000	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0051716	0.940	cellular response to stimulus
GO:0007264	0.812	small GTPase mediated signal transduction
GO:0007265	0.729	Ras protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0000932	0.997	P-body
GO:0043227	0.737	membrane-bounded organelle
GO:0043231	0.672	intracellular membrane-bounded organelle
GO:0031981	0.337	nuclear lumen
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]