StarFunc result for job id O15067

User Input

>input (1338 residues)
MSPVLHFYVRPSGHEGAAPGHTRRKLQGKLPELQGVETELCYNVNWTAEALPSAEETKKL
MWLFGCPLLLDDVARESWLLPGSNDLLLEVGPRLNFSTPTSTNIVSVCRATGLGPVDRVE
TTRRYRLSFAHPPSAEVEAIALATLHDRMTEQHFPHPIQSFSPESMPEPLNGPINILGEG
RLALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEAFDLAQSNSEHSRHWFFKGQLH
VDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQG
LRHVVFTAETHNFPTGVCPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPGY
NLPWEDPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREW
IKPIMFSGGIGSMEADHISKEAPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSDLD
FGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTS
RFQLGDPTLNALEIWGAEYQESNALLLRSPNRDFLTHVSARERCPACFVGTITGDRRIVL
VDDRECPVRRNGQGDAPPTPLPTPVDLELEWVLGKMPRKEFFLQRKPPMLQPLALPPGLS
VHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIG
AATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAA
LADACEAMVAVMAALGVAVDGGKDSLSMAARVGTETVRAPGSLVISAYAVCPDITATVTP
DLKHPEGRGHLLYVALSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFSITQGLLK
DRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPD
LAQVLKRYRDAGLHCLELGHTGEAGPHAMVRVSVNGAVVLEEPVGELRALWEETSFQLDR
LQAEPRCVAEEERGLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMA
DAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAG
AELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSG
RYESRWASVRVGPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWA
DDDGNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAVRPWQWAWRPPPFDTLTTS
PWLQLFINARNWTLEGSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AB17	0.930	0.979	0.000	1271	0.833	0.876	D4AB17.pdb.gz	D4AB17_RAT phosphoribosylformylglycinamidine synthase OS=Rattus norvegicus OX=10116 GN=Pfas PE=1 SV=4
2	AFDB:O14228	0.922	0.933	0.000	1323	0.345	0.349	O14228.pdb.gz	PUR4_SCHPO Phosphoribosylformylglycinamidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade3 PE=1 SV=1
3	AFDB:O15067	1.000	1.000	0.000	1338	1.000	1.000	O15067.pdb.gz	PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4
4	AFDB:P15254	0.914	0.944	0.000	1295	0.355	0.367	P15254.pdb.gz	PUR4_ECOLI Phosphoribosylformylglycinamidine synthase OS=Escherichia coli (strain K12) OX=83333 GN=purL PE=1 SV=3
5	AFDB:P35421	0.949	0.938	0.000	1354	0.507	0.501	P35421.pdb.gz	PUR4_DROME Phosphoribosylformylglycinamidine synthase OS=Drosophila melanogaster OX=7227 GN=Pfas PE=1 SV=2
6	AFDB:P38972	0.926	0.913	0.000	1358	0.352	0.347	P38972.pdb.gz	PUR4_YEAST Phosphoribosylformylglycinamidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE6 PE=1 SV=2
7	AFDB:Q9M8D3	0.961	0.914	0.000	1407	0.504	0.480	Q9M8D3.pdb.gz	PUR4_ARATH Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g74260 PE=2 SV=3
8	AFDB:P9WHL7	0.502	0.857	1.052E-51	766	0.139	0.243	P9WHL7.pdb.gz	PURL_MYCTU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purL PE=1 SV=2
9	AFDB:P12042	0.494	0.871	1.274E-48	742	0.123	0.222	P12042.pdb.gz	PURL_BACSU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus subtilis (strain 168) OX=224308 GN=purL PE=1 SV=2
10	AFDB:Q9X0X3	0.392	0.824	2.783E-32	603	0.100	0.222	Q9X0X3.pdb.gz	PURL_THEMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=purL PE=1 SV=1
11	PDB:2hs3A	0.376	0.796	4.918E-30	602	0.098	0.218	2hs3A.pdb.gz	Complexed Structures of Formylglycinamide Ribonucleotide Amidotransferase from Thermotoga maritima Describe a Novel ATP Binding Protein Superfamily
12	PDB:2hruA	0.368	0.803	3.512E-29	581	0.088	0.203	2hruA.pdb.gz	Complexed Structures of Formylglycinamide Ribonucleotide Amidotransferase from Thermotoga maritima Describe a Novel ATP Binding Protein Superfamily
13	PDB:3vytC	0.166	0.602	4.912E-12	336	0.038	0.152	3vytC.pdb.gz	Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
14	PDB:3u0oB	0.167	0.561	3.444E-9	335	0.045	0.179	3u0oB.pdb.gz	Structural insights into the catalytic mechanism of Escherichia coli selenophosphate synthetase.
15	PDB:3fd5B	0.161	0.524	1.084E-8	355	0.036	0.135	3fd5B.pdb.gz	Crystal structures of catalytic intermediates of human selenophosphate synthetase 1.
16	PDB:1cliA	0.150	0.514	4.020E-8	341	0.030	0.117	1cliA.pdb.gz	X-ray crystal structure of aminoimidazole ribonucleotide synthetase (PurM), from the Escherichia coli purine biosynthetic pathway at 2.5 A resolution.
17	PDB:2i6rD	0.160	0.582	9.631E-8	322	0.040	0.165	2i6rD.pdb.gz
18	PDB:5l16A	0.147	0.525	1.336E-7	323	0.034	0.142	5l16A.pdb.gz
19	PDB:6vtvB	0.117	0.528	7.531E-5	252	0.037	0.198	6vtvB.pdb.gz	PuuD gamma-glutamyl-gamma-aminobutyrate hydrolase
20	PDB:1jdbF	0.112	0.340	9.370E-5	380	0.031	0.111	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AB17	0.0	2435	1337	0.891	0.892	D4AB17_RAT phosphoribosylformylglycinamidine synthase OS=Rattus norvegicus OX=10116 GN=Pfas PE=1 SV=4
2	O14228	0.0	711	1323	0.352	0.356	PUR4_SCHPO Phosphoribosylformylglycinamidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade3 PE=1 SV=1
3	O15067	0.0	2731	1338	1.000	1.000	PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4
4	P15254	0.0	753	1295	0.356	0.368	PUR4_ECOLI Phosphoribosylformylglycinamidine synthase OS=Escherichia coli (strain K12) OX=83333 GN=purL PE=1 SV=3
5	P35421	0.0	1266	1354	0.506	0.500	PUR4_DROME Phosphoribosylformylglycinamidine synthase OS=Drosophila melanogaster OX=7227 GN=Pfas PE=1 SV=2
6	P38972	0.0	687	1358	0.348	0.343	PUR4_YEAST Phosphoribosylformylglycinamidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE6 PE=1 SV=2
7	Q5SUR0	0.0	2411	1337	0.885	0.886	PUR4_MOUSE Phosphoribosylformylglycinamidine synthase OS=Mus musculus OX=10090 GN=Pfas PE=1 SV=1
8	Q9M8D3	0.0	1285	1407	0.504	0.480	PUR4_ARATH Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g74260 PE=2 SV=3
9	Q66542	1.12e-69	259	1318	0.175	0.178	Q66542_EBVG p140 OS=Epstein-Barr virus (strain GD1) OX=10376 GN=BNRF1 PE=1 SV=1
10	P03179	1.38e-68	256	1318	0.174	0.177	MTP_EBVB9 Major tegument protein OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BNRF1 PE=1 SV=1
11	P88964	1.86e-64	243	1296	0.170	0.175	P88964_HHV8 ORF 75 OS=Human herpesvirus 8 type M OX=435895 PE=1 SV=1
12	D0UZU4	2.25e-64	243	1296	0.170	0.175	D0UZU4_HHV8 ORF75 OS=Human herpesvirus 8 OX=37296 GN=ORF75 PE=1 SV=1
13	O41977	1.62e-33	143	1275	0.136	0.143	O41977_MHV68 75b OS=Murid herpesvirus 4 OX=33708 GN=GAMMAHV.ORF75b PE=1 SV=1
14	P9WHL7	1.13e-22	107	766	0.121	0.211	PURL_MYCTU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purL PE=1 SV=2
15	P12042	2.17e-20	100	742	0.135	0.244	PURL_BACSU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus subtilis (strain 168) OX=224308 GN=purL PE=1 SV=2
16	Q9X0X3	6.73e-16	85.1	603	0.059	0.131	PURL_THEMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=purL PE=1 SV=1
17	P9WHL5	1.17e-04	47.4	224	0.052	0.308	PURQ_MYCTU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purQ PE=1 SV=1
18	M0QXW7	4.0	32.3	116	0.014	0.164	M0QXW7_HUMAN KH-type splicing regulatory protein (Fragment) OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=1
19	F8VZ73	4.2	32.0	107	0.024	0.299	F8VZ73_HUMAN Zinc finger protein 641 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF641 PE=4 SV=1
20	F8VXJ5	4.4	32.3	136	0.022	0.221	F8VXJ5_HUMAN Zinc finger protein 641 (Fragment) OS=Homo sapiens OX=9606 GN=ZNF641 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02769 AIRS_C	1.9e-30	117.5	AIR synthase related protein, C-terminal domain
2	PF18072 FGAR-AT_linker	3.6e-07	41.9	Formylglycinamide ribonucleotide amidotransferase linker domain
3	PF18076 FGAR-AT_N	8.8e-08	43.5	Formylglycinamide ribonucleotide amidotransferase N-terminal
4	PF13507 GATase_5	1.9e-93	323.9	CobB/CobQ-like glutamine amidotransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371253	0.999	Trifunctional purine biosynthetic protein adenosine-3
2	9606.ENSP00000264220	0.994	Amidophosphoribosyltransferase
3	9606.ENSP00000236959	0.988	Bifunctional purine biosynthesis protein PURH
4	9606.ENSP00000382595	0.987	Multifunctional protein ADE2
5	9606.ENSP00000419851	0.969	GMP synthase [glutamine-hydrolyzing]
6	9606.ENSP00000485525	0.941	Adenylosuccinate lyase
7	9606.ENSP00000368959	0.916	Receptor expression-enhancing protein 5
8	9606.ENSP00000476535	0.886	annotation not available
9	9606.ENSP00000264705	0.862	CAD protein
10	9606.ENSP00000402608	0.798	Carbamoyl-phosphate synthase [ammonia], mitochondrial
11	9606.ENSP00000370625	0.763	DNA-directed RNA polymerase II subunit RPB2
12	9606.ENSP00000333667	0.754	Serine hydroxymethyltransferase, mitochondrial
13	9606.ENSP00000293677	0.730	Ribonucleoprotein PTB-binding 1
14	9606.ENSP00000355493	0.721	Adenylosuccinate synthetase isozyme 2
15	9606.ENSP00000318868	0.699	Serine hydroxymethyltransferase, cytosolic
16	9606.ENSP00000377954	0.694	Leucine--tRNA ligase, cytoplasmic
17	9606.ENSP00000367893	0.693	Selenide, water dikinase 1
18	9606.ENSP00000447731	0.682	Transmembrane protein 116
19	9606.ENSP00000232607	0.668	Uridine 5'-monophosphate synthase
20	9606.ENSP00000361704	0.668	CTP synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004642	1.000	phosphoribosylformylglycinamidine synthase activity
GO:0005488	0.979	binding
GO:0005515	0.830	protein binding
GO:1901363	0.726	heterocyclic compound binding
GO:0097159	0.723	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0044271	0.965	cellular nitrogen compound biosynthetic process
GO:0019438	0.963	aromatic compound biosynthetic process
GO:0018130	0.963	heterocycle biosynthetic process
GO:0044281	0.962	small molecule metabolic process
GO:1901362	0.961	organic cyclic compound biosynthetic process
GO:0055086	0.950	nucleobase-containing small molecule metabolic process
GO:0072522	0.928	purine-containing compound biosynthetic process
GO:1901293	0.885	nucleoside phosphate biosynthetic process
GO:0009165	0.866	nucleotide biosynthetic process
GO:0006163	0.853	purine nucleotide metabolic process
GO:0009123	0.820	nucleoside monophosphate metabolic process
GO:0006164	0.816	purine nucleotide biosynthetic process
GO:0009161	0.806	ribonucleoside monophosphate metabolic process
GO:0009124	0.806	nucleoside monophosphate biosynthetic process
GO:0046390	0.793	ribose phosphate biosynthetic process
GO:0009126	0.790	purine nucleoside monophosphate metabolic process
GO:0009259	0.787	ribonucleotide metabolic process
GO:0009150	0.780	purine ribonucleotide metabolic process
GO:0009156	0.776	ribonucleoside monophosphate biosynthetic process
GO:0009127	0.755	purine nucleoside monophosphate biosynthetic process
GO:0009167	0.754	purine ribonucleoside monophosphate metabolic process
GO:0009260	0.750	ribonucleotide biosynthetic process
GO:0009168	0.709	purine ribonucleoside monophosphate biosynthetic process
GO:0009152	0.673	purine ribonucleotide biosynthetic process
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0005576	0.991	extracellular region
GO:0070062	0.981	extracellular exosome
GO:0043229	0.941	intracellular organelle
GO:0043231	0.923	intracellular membrane-bounded organelle
GO:0043233	0.871	organelle lumen
GO:0070013	0.825	intracellular organelle lumen
GO:0005634	0.367	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17129	1.000	ATP + H2O + L-glutamine + N(2)-formyl-N(1)-(5-phospho-beta-D-ribosyl)glycinamide = 2-formamido-N(1)-(5-O-phospho-beta-D-ribosyl)acetamidine + ADP + H(+) + L-glutamate + phosphate
EC:6.3.5.3	1.000	phosphoribosylformylglycinamidine synthase.

[back to server]