StarFunc result for job id O15068

User Input

>input (1137 residues)
MFDCWRFILCKRPGSNSYSSPQRPNEAKKEETDHQIDVSDVIRLVQDTPEATAMATDEIM
HQDIVPLCAADIQDQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTS
IPSLQDAGIGFILVIDRRRDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIA
FKFNRDDFKMKVPVIMLSSVPDLHGYIDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALM
VKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLR
ELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGF
REVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIG
NKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLAS
QPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQ
ASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALR
RGPYRRAKSEMSESRQGRGSAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAE
MDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFHNRIFLRELENYTDCPELVGRCFLERMED
FQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKE
MLKYSRNCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWT
DHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVG
ITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRAL
EQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTS
HSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKGGPDALRVRSGD
VVELVQEGDEGLWYVRDPTTGKEGWVPASSLSVRLGPSGSAQCLSSSGKAHVPRAHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15068	1.000	1.000	0.000	1137	1.000	1.000	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
2	AFDB:Q63406	0.716	0.709	0.000	1149	0.863	0.854	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
3	AFDB:Q6PDM6	0.633	0.619	0.000	1166	0.847	0.826	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
4	AFDB:Q8BLE2	0.624	0.681	4.294E-76	1031	0.385	0.425	Q8BLE2.pdb.gz	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
5	AFDB:P10911	0.413	0.491	1.235E-66	925	0.372	0.457	P10911.pdb.gz	MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens OX=9606 GN=MCF2 PE=1 SV=3
6	AFDB:H2KYI7	0.417	0.445	1.705E-55	1055	0.242	0.261	H2KYI7.pdb.gz	H2KYI7_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgef-1 PE=4 SV=2
7	AFDB:A0A2R8RHL8	0.315	0.159	1.731E-41	2306	0.274	0.135	A0A2R8RHL8.pdb.gz	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
8	AFDB:A0A2R8QD21	0.351	0.210	2.157E-41	1989	0.236	0.135	A0A2R8QD21.pdb.gz
9	AFDB:A0A0R4I9W4	0.330	0.233	6.873E-36	1632	0.249	0.173	A0A0R4I9W4.pdb.gz
10	AFDB:B7YZI8	0.238	0.551	7.963E-19	443	0.088	0.226	B7YZI8.pdb.gz	B7YZI8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG15612 PE=4 SV=1
11	PDB:4mt6A	0.191	0.431	3.645E-15	389	0.077	0.224	4mt6A.pdb.gz
12	PDB:7rx9A	0.149	0.381	2.214E-14	432	0.075	0.197	7rx9A.pdb.gz
13	PDB:4gouA	0.135	0.287	7.932E-8	507	0.043	0.097	4gouA.pdb.gz
14	PDB:7wvtA	0.117	0.306	3.924E-5	364	0.033	0.102	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
15	PDB:3pvuA	0.077	0.133	9.322E-4	609	0.029	0.054	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:4mk0A	0.084	0.143	9.741E-4	631	0.034	0.062	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:4cizA	0.124	0.432	1.885E-3	284	0.023	0.092	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
18	PDB:4tlgA	0.108	0.272	2.680E-3	396	0.027	0.078	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:6u3eA	0.083	0.189	2.800E-3	397	0.045	0.128	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:4uybA	0.107	0.267	3.195E-3	401	0.026	0.075	4uybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AET8	0.0	756	944	0.351	0.423	A2AET8_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=4 SV=1
2	O15068	0.0	2362	1137	1.000	1.000	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
3	P10911	0.0	801	925	0.373	0.458	MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens OX=9606 GN=MCF2 PE=1 SV=3
4	Q63406	0.0	1994	1149	0.864	0.855	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
5	Q64096	0.0	2006	1149	0.870	0.861	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
6	Q6PDM6	0.0	1908	1166	0.841	0.820	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
7	Q7TNJ5	0.0	753	944	0.350	0.422	Q7TNJ5_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
8	Q8BLE2	0.0	823	1031	0.377	0.416	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
9	Q8C067	0.0	759	928	0.349	0.428	Q8C067_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
10	Q99N72	0.0	756	928	0.348	0.427	Q99N72_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=1 SV=1
11	H2KYI7	4.25e-125	412	1055	0.236	0.254	H2KYI7_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgef-1 PE=4 SV=2
12	A0A2R8RHL8	2.36e-65	245	2306	0.161	0.079	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
13	H7BXZ5	7.08e-60	228	2955	0.149	0.057	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
14	O60229	8.19e-60	228	2986	0.149	0.057	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
15	A2CG49	4.40e-59	226	2964	0.145	0.056	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
16	P97924	1.14e-58	224	2959	0.120	0.046	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
17	Q0KL02	4.53e-58	223	3102	0.178	0.065	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
18	F1M0Z1	5.94e-58	222	3100	0.145	0.053	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
19	O75962	6.82e-58	222	3097	0.145	0.053	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
20	Q7KVD1	2.25e-55	214	2263	0.147	0.074	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13716 CRAL_TRIO_2	1.1e-06	40.4	Divergent CRAL/TRIO domain
2	PF14132 DUF4299	2e+02	13.0	Domain of unknown function (DUF4299)
3	PF00169 PH	9.2e-05	34.3	PH domain
4	PF15411 PH_10	14	17.3	Pleckstrin homology domain
5	PF00621 RhoGEF	3.3e-34	130.2	RhoGEF domain
6	PF00018 SH3_1	0.22	22.5	SH3 domain
7	PF07653 SH3_2	0.11	23.6	Variant SH3 domain
8	PF14604 SH3_9	1.2	20.4	Variant SH3 domain
9	PF00435 Spectrin	3.9e-05	35.4	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000006288

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002031	0.953	Cell division cycle 42
2	9601.ENSPPYP00000015522	0.944	Transforming protein RhoA
3	9601.ENSPPYP00000001186	0.782	Rho-related GTP-binding protein RhoC
4	9601.ENSPPYP00000011947	0.782	Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells (By similarity)
5	9601.ENSPPYP00000004149	0.719	Ras homolog family member G
6	9601.ENSPPYP00000000131	0.696	Ras homolog family member U
7	9601.ENSPPYP00000006693	0.696	Ras homolog family member J
8	9601.ENSPPYP00000007208	0.696	Ras homolog family member V
9	9601.ENSPPYP00000013889	0.696	Ras homolog family member Q
10	9601.ENSPPYP00000007657	0.663	Neurotrophic tyrosine kinase, receptor, type 3
11	9601.ENSPPYP00000007834	0.653	Mitochondrial Rho GTPase
12	9601.ENSPPYP00000024079	0.653	Ras homolog family member T1
13	9601.ENSPPYP00000019439	0.643	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
14	9601.ENSPPYP00000004761	0.631	Neurotrophin 3
15	9601.ENSPPYP00000009837	0.631	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
16	9601.ENSPPYP00000013154	0.631	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
17	9601.ENSPPYP00000003479	0.620	Ras homolog family member D
18	9601.ENSPPYP00000005759	0.620	Ras homolog family member F (in filopodia)
19	9601.ENSPPYP00000016404	0.620	Ras homolog family member H
20	9601.ENSPPYP00000007447	0.609	Immunoglobulin superfamily, DCC subclass, member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0035091	0.998	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.930	positive regulation of biological process
GO:0048522	0.920	positive regulation of cellular process
GO:0009987	0.906	cellular process
GO:1902533	0.859	positive regulation of intracellular signal transduction
GO:0035025	0.849	positive regulation of Rho protein signal transduction
GO:0050896	0.462	response to stimulus
GO:0007154	0.414	cell communication
GO:0051716	0.398	cellular response to stimulus
GO:0007165	0.381	signal transduction
GO:0019222	0.374	regulation of metabolic process
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0012505	0.991	endomembrane system
GO:0071944	0.974	cell periphery
GO:0019898	0.974	extrinsic component of membrane
GO:0005576	0.967	extracellular region
GO:0005886	0.964	plasma membrane
GO:0005829	0.959	cytosol
GO:0043226	0.941	organelle
GO:0043227	0.870	membrane-bounded organelle
GO:0005615	0.844	extracellular space
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0019897	0.451	extrinsic component of plasma membrane
GO:0098562	0.446	cytoplasmic side of membrane
GO:0009898	0.443	cytoplasmic side of plasma membrane
GO:0031234	0.431	extrinsic component of cytoplasmic side of plasma membrane
GO:0042995	0.430	cell projection
GO:0120025	0.389	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]