StarFunc result for job id O15069

User Input

>input (1562 residues)
MPGEAARAELLLPEADRPGPRTDLSCDAAAATTILGGDRREPCALTPGPSHLALTFLPSK
PGARPQPEGASWDAGPGGAPSAWADPGEGGPSPMLLPEGLSSQALSTEAPLPATLEPRIV
MGEETCQALLSPRAARTALRDQEGGHASPDPPPELCSQGDLSVPSPPPDPDSFFTPPSTP
TKTTYALLPACGPHGDARDSEAELRDELLDSPPASPSGSYITADGDSWASSPSCSLSLLA
PAEGLDFPSGWGLSPQGSMVDERELHPAGTPEPPSSESSLSADSSSSWGQEGHFFDLDFL
ANDPMIPAALLPFQGSLIFQVEAVEVTPLSPEEEEEEAVADPDPGGDLAGEGEEDSTSAS
FLQSLSDLSITEGMDEAFAFRDDTSAASSDSDSASYAEADDERLYSGEPHAQATLLQDSV
QKTEEESGGGAKGLQAQDGTVSWAVEAAPQTSDRGAYLSQRQELISEVTEEGLALGQEST
ATVTPHTLQVAPGLQVEVATRVTPQAGEEETDSTAGQESAAMAMPQPSQEGISEILGQES
VTAEKLPTPQEETSLTLCPDSPQNLKEEGGLDLPSGRKPVAAATIVPRQAKEDLTLPQDS
AMTPPLPLQDTDLSSAPKPVAAATIVSQQAEEGLTLPQDSVMTPPLPLQDTELSSAPKPV
AAATLVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATLVSQQAEEGLTLPQDS
AMTPPLPLQDTDLSSAPKPVAAATLVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPV
AAATIVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATIVSQQAEEGLTLPQDS
AMTPPLPLQDTDLSSAPKPVAAATPVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPV
AAATPVSQQAEEGLTLPQDSAMTAPLPLQDTGPTSGPEPLAVATPQTLQAEAGCAPGTEP
VATMAQQEVGEALGPRPAPEEKNAALPTVPEPAALDQVQQDDPQPAAEAGTPWAAQEDAD
STLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLEVENQQ
EGGLKPLAQEHGPRSALGGAREVPDAPPAACPEVSQARLLSPAREERGLSGKSTPEPTLP
SAVATEASLDSCPESSVGAVSSLDRGCPDAPAPTSAPTSQQPEPVLGLGSVEQPHEVPSV
LGTPLLQPPENLAKGQPSTPVDRPLGPDPSAPGTLAGAALPPLEPPAPCLCQDPQEDSVE
DEEPPGSLGLPPPQAGVQPAAAAVSGTTQPLGTGPRVSLSPHSPLLSPKVASMDAKDLAL
QILPPCQVPPPSGPQSPAGPQGLSAPEQQEDEDSLEEDSPRALGSGQHSDSHGESSAELD
EQDILAPQTVQCPAQAPAGGSEETIAKAKQSRSEKKARKAMSKLGLRQIQGVTRITIQKS
KNILFVIAKPDVFKSPASDTYVVFGEAKIEDLSQQVHKAAAEKFKVPSEPSALVPESAPR
PRVRLECKEEEEEEEEEVDEAGLELRDIELVMAQANVSRAKAVRALRDNHSDIVNAIMEL
TM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15069	1.000	1.000	0.000	1562	1.000	1.000	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
2	AFDB:P70670	0.087	0.065	1.933E-22	2187	0.265	0.189	P70670.pdb.gz	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
3	PDB:7qwrt	0.042	0.900	1.756E-8	67	0.038	0.896	7qwrt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
4	PDB:7qwqt	0.030	0.845	1.813E-3	47	0.024	0.809	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
5	AFDB:Q9H792	0.037	0.035	5.071E-3	1746	0.133	0.119	Q9H792.pdb.gz	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4
6	AFDB:Q69Z38	0.037	0.035	3.581E-2	1735	0.144	0.130	Q69Z38.pdb.gz	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4
7	AFDB:M9PHT1	0.035	0.031	8.952E-2	2007	0.179	0.139	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
8	AFDB:O88466	0.040	0.036	1.373E-1	1888	0.157	0.130	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
9	PDB:6c95D	0.025	0.395	1.474E-1	95	0.012	0.200	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
10	AFDB:O42854	0.047	0.046	1.551E-1	1611	0.163	0.158	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
11	AFDB:P47068	0.050	0.059	1.753E-1	1157	0.106	0.143	P47068.pdb.gz	BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BBC1 PE=1 SV=2
12	AFDB:Q54S20	0.034	0.024	3.229E-1	2678	0.123	0.072	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
13	AFDB:Q9VWC6	0.030	0.030	3.229E-1	1596	0.133	0.130	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
14	PDB:5yzgY	0.021	0.094	3.467E-1	204	0.006	0.049	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:7av6A	0.024	0.201	3.685E-1	99	0.007	0.111	7av6A.pdb.gz
16	PDB:7myjC	0.022	0.057	5.001E-1	465	0.013	0.045	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:2qzvA	0.023	0.043	8.153E-1	749	0.006	0.013	2qzvA.pdb.gz
18	PDB:4xb6C	0.022	0.098	9.212E-1	353	0.007	0.031	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
19	PDB:7nvrl	0.018	0.041	9.793E-1	501	0.007	0.022	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
20	PDB:7r04A	0.025	0.020	9.793E-1	2326	0.010	0.006	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15069	0.0	3006	1562	1.000	1.000	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
2	Q13765	3.23e-67	228	215	0.084	0.609	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
3	Q60817	3.23e-67	228	215	0.084	0.609	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1
4	Q8JIU7	7.91e-66	224	215	0.083	0.605	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
5	P70670	1.99e-60	232	2187	0.090	0.064	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
6	Q94518	9.50e-53	186	217	0.062	0.447	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
7	Q86S66	7.35e-46	166	195	0.061	0.492	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
8	Q94JX9	1.82e-43	160	217	0.056	0.406	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
9	Q9LHG9	8.30e-43	157	203	0.058	0.448	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
10	Q9SZY1	2.86e-42	156	212	0.055	0.406	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
11	Q8LGC6	5.85e-41	152	209	0.054	0.402	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
12	Q6ICZ8	5.14e-36	138	204	0.064	0.490	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
13	P87147	4.31e-33	128	173	0.049	0.445	NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egd2 PE=1 SV=1
14	Q6FJD5	1.79e-25	106	165	0.040	0.376	NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGD2 PE=3 SV=1
15	Q9VPV7	1.91e-23	105	347	0.043	0.193	Q9VPV7_DROME GH09281p OS=Drosophila melanogaster OX=7227 GN=gNacalpha PE=2 SV=2
16	Q5ANP2	9.22e-22	96.3	178	0.042	0.371	NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EGD2 PE=3 SV=1
17	Q38EE8	3.89e-21	94.7	188	0.036	0.298	Q38EE8_TRYB2 Nascent polypeptide associated complex subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0120 PE=4 SV=1
18	P38879	1.28e-19	90.1	174	0.040	0.362	NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD2 PE=1 SV=3
19	Q9CR41	0.023	38.9	121	0.012	0.149	HYPK_MOUSE Huntingtin-interacting protein K OS=Mus musculus OX=10090 GN=Hypk PE=1 SV=3
20	Q9NX55	0.023	38.9	121	0.012	0.149	HYPK_HUMAN Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19026 HYPK_UBA	5.7e-06	36.9	HYPK UBA domain
2	PF01849 NAC	3.2e-17	73.6	NAC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420477

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369965	0.901	Transcription factor BTF3
2	9606.ENSP00000360664	0.852	Basic transcription factor 3 like 4
3	9606.ENSP00000259469	0.702	60S ribosomal protein L35
4	9606.ENSP00000435370	0.698	Ubiquitin-like protein FUBI
5	9606.ENSP00000311430	0.687	L ribosomal proteins
6	9606.ENSP00000375730	0.671	60S ribosomal protein L13a
7	9606.ENSP00000473383	0.666	rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1
8	9606.ENSP00000377640	0.665	Ribosomal protein L24
9	9606.ENSP00000379888	0.665	Ribosomal protein S8
10	9606.ENSP00000307889	0.657	Ribosomal protein L13
11	9606.ENSP00000278572	0.656	40S ribosomal protein S3
12	9606.ENSP00000354739	0.653	60S ribosomal protein L12
13	9606.ENSP00000262584	0.651	60S ribosomal protein L8
14	9606.ENSP00000346027	0.651	60S ribosomal protein L21
15	9606.ENSP00000225430	0.650	Ribosomal protein L19
16	9606.ENSP00000309334	0.650	Ribosomal protein L15
17	9606.ENSP00000416429	0.650	Ribosomal protein L32
18	9606.ENSP00000222247	0.647	Belongs to the eukaryotic ribosomal protein eL20 family.
19	9606.ENSP00000322419	0.641	60S acidic ribosomal protein P2
20	9606.ENSP00000467466	0.639	Ribosomal protein S15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.804	biological regulation
GO:0050789	0.787	regulation of biological process
GO:0008152	0.785	metabolic process
GO:0071704	0.773	organic substance metabolic process
GO:0050794	0.654	regulation of cellular process
GO:0051179	0.601	localization
GO:0043170	0.597	macromolecule metabolic process
GO:0044238	0.592	primary metabolic process
GO:0044237	0.582	cellular metabolic process
GO:0006807	0.567	nitrogen compound metabolic process
GO:0019538	0.540	protein metabolic process
GO:0009058	0.405	biosynthetic process
GO:1901576	0.402	organic substance biosynthetic process
GO:0044249	0.402	cellular biosynthetic process
GO:0071840	0.332	cellular component organization or biogenesis
GO:0034641	0.321	cellular nitrogen compound metabolic process
GO:0044260	0.321	cellular macromolecule metabolic process
GO:0010467	0.311	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0043228	0.994	non-membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0016020	0.978	membrane
GO:0070013	0.978	intracellular organelle lumen
GO:0005829	0.975	cytosol
GO:0012505	0.973	endomembrane system
GO:0031981	0.950	nuclear lumen
GO:0032991	0.438	protein-containing complex
GO:0005654	0.334	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]