StarFunc result for job id O15072

User Input

>input (1205 residues)
MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHT
LSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWHETSLVPGNI
TDPINNHQPGSATYRIRRTEPLQTNCAYVGDIVDIPGTSVAISNCDGLAGMIKSDNEEYF
IEPLERGKQMEEEKGRIHVVYKRSAVEQAPIDMSKDFHYRESDLEGLDDLGTVYGNIHQQ
LNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHC
MWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYM
KQLVHDGTHCSYKDPYSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFT
RTPRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGEEAKSRTFIDL
GVEWDYNIEDDIESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNVI
QEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCN
IQECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRP
CNRVPCPAQWKTGPWSECSVTCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPC
LGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLLEAAETHDDVISNPSDLP
RSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGANLRQRSAQQAGSK
TVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIIDNRRPTRS
STLER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RY45	0.462	0.463	0.000	1204	0.866	0.867	B2RY45.pdb.gz	B2RY45_MOUSE Adamts3 protein OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
2	AFDB:O15072	1.000	1.000	0.000	1205	1.000	1.000	O15072.pdb.gz	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
3	PDB:4q1lA	0.150	0.827	1.402E-12	202	0.044	0.262	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
4	PDB:1w0rA	0.061	0.132	2.161E-8	442	0.076	0.206	1w0rA.pdb.gz
5	PDB:7ufgA	0.107	0.112	7.599E-6	1151	0.100	0.104	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
6	PDB:7ufgB	0.107	0.108	7.589E-5	1182	0.085	0.087	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
7	PDB:4e0sB	0.053	0.069	6.791E-4	898	0.022	0.030	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
8	PDB:3t5oA	0.038	0.051	7.578E-4	871	0.023	0.032	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
9	PDB:6oj0Z	0.069	0.359	8.456E-4	180	0.014	0.094	6oj0Z.pdb.gz
10	AFDB:Q2EY15	0.052	0.053	8.546E-4	1191	0.066	0.067	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
11	PDB:7nycC	0.047	0.065	1.385E-3	809	0.026	0.038	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	PDB:8a7eC	0.100	0.083	3.149E-3	1524	0.076	0.060	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
13	PDB:7nydE	0.047	0.109	4.375E-3	484	0.027	0.068	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	AFDB:Q6FW69	0.056	0.090	1.063E-2	676	0.063	0.112	Q6FW69.pdb.gz	Q6FW69_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGT2 PE=4 SV=1
15	AFDB:P37963	0.031	0.050	1.323E-2	575	0.056	0.117	P37963.pdb.gz	SP6D_BACSU Stage VI sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoVID PE=1 SV=1
16	AFDB:Q6IEE6	0.060	0.066	3.957E-2	1074	0.071	0.079	Q6IEE6.pdb.gz	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
17	AFDB:A0A2R8QL08	0.044	0.032	4.416E-2	2036	0.072	0.043	A0A2R8QL08.pdb.gz
18	AFDB:P13595	0.065	0.069	4.664E-2	1115	0.046	0.049	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
19	AFDB:Q59IW5	0.032	0.033	6.845E-2	1115	0.056	0.061	Q59IW5.pdb.gz	Q59IW5_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
20	AFDB:A0A0R4IAW3	0.053	0.066	7.230E-2	898	0.041	0.056	A0A0R4IAW3.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RXR8	0.0	1333	1206	0.536	0.536	B2RXR8_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=2 SV=1
2	B2RXX5	0.0	1334	1206	0.536	0.536	B2RXX5_MOUSE A Disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
3	B2RY45	0.0	2187	1204	0.867	0.868	B2RY45_MOUSE Adamts3 protein OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
4	B2RY57	0.0	2230	1203	0.882	0.884	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
5	E9PX39	0.0	1347	1209	0.539	0.537	E9PX39_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
6	E9Q287	0.0	2190	1204	0.868	0.869	E9Q287_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
7	G3X9D2	0.0	2231	1203	0.883	0.884	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
8	O15072	0.0	2533	1205	1.000	1.000	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
9	O95450	0.0	1341	1211	0.542	0.539	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
10	P79331	0.0	1357	1205	0.538	0.538	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1
11	Q8C9W3	0.0	1358	1213	0.541	0.538	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
12	Q8WXS8	0.0	1330	1223	0.529	0.521	ATS14_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 14 OS=Homo sapiens OX=9606 GN=ADAMTS14 PE=2 SV=2
13	Q9UKP5	1.39e-167	528	1117	0.280	0.302	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
14	D3Z1A5	2.66e-167	528	1117	0.280	0.303	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
15	Q8TE60	4.73e-163	520	1221	0.280	0.276	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
16	Q4VC17	9.04e-156	500	1219	0.278	0.275	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
17	E7FEJ5	2.30e-154	497	1244	0.275	0.266	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
18	Q68SA9	4.57e-148	488	1657	0.277	0.202	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
19	D3ZLL7	1.75e-147	478	1221	0.262	0.259	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
20	Q9UKP4	1.01e-146	485	1686	0.270	0.193	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	3.2e-16	70.9	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.0001	33.7	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	4.4e-24	96.4	ADAM-TS Spacer 1
4	PF16313 DUF4953	2.4e+02	12.3	Met-zincin
5	PF00413 Peptidase_M10	7.1	17.9	Matrixin
6	PF01562 Pep_M12B_propep	1.1e-39	147.4	Reprolysin family propeptide
7	PF08686 PLAC	2.8	20.1	PLAC (protease and lacunin) domain
8	PF01421 Reprolysin	1.2e-17	76.1	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	9.7e-07	40.4	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	5.2e-07	41.6	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	0.0037	28.5	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	6.5e-11	54.3	Metallo-peptidase family M12
13	PF19030 TSP1_ADAMTS	9.3e-27	104.4	Thrombospondin type 1 domain
14	PF19035 TSP1_CCN	0.56	21.9	CCN3 Nov like TSP1 domain
15	PF19028 TSP1_spondin	9.7e-05	33.9	Spondin-like TSP1 domain
16	PF00090 TSP_1	1.7e-18	77.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369889	0.971	Collagen alpha-1(II) chain
2	9606.ENSP00000225964	0.948	Collagen alpha-1(I) chain
3	9606.ENSP00000297268	0.941	Collagen alpha-2(I) chain
4	9606.ENSP00000359114	0.940	Collagen alpha-1(XI) chain
5	9606.ENSP00000304408	0.937	Collagen alpha-1(III) chain
6	9606.ENSP00000364000	0.930	Collagen alpha-2(V) chain
7	9606.ENSP00000360882	0.929	Collagen alpha-1(V) chain
8	9606.ENSP00000363840	0.929	Collagen alpha-2(XI) chain
9	9606.ENSP00000264828	0.923	Collagen alpha-3(V) chain
10	9606.ENSP00000284987	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 5
11	9606.ENSP00000284984	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 1
12	9606.ENSP00000373472	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 7
13	9606.ENSP00000418735	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 9
14	9606.ENSP00000422554	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 12
15	9606.ENSP00000374071	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 20
16	9606.ENSP00000299164	0.917	ADAM metallopeptidase with thrombospondin type 1 motif 15
17	9606.ENSP00000360997	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 13
18	9606.ENSP00000260356	0.916	Thrombospondin-1
19	9606.ENSP00000348385	0.915	Collagen alpha-1(XXVII) chain
20	9606.ENSP00000370443	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005515	0.998	protein binding
GO:0008237	0.992	metallopeptidase activity
GO:0004175	0.986	endopeptidase activity
GO:0004222	0.961	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.987	protein metabolic process
GO:0048856	0.983	anatomical structure development
GO:0032501	0.975	multicellular organismal process
GO:0007275	0.973	multicellular organism development
GO:0006508	0.969	proteolysis
GO:0050789	0.771	regulation of biological process
GO:0009987	0.760	cellular process
GO:0050794	0.702	regulation of cellular process
GO:0051604	0.659	protein maturation
GO:0016485	0.642	protein processing
GO:0048583	0.437	regulation of response to stimulus
GO:0071840	0.378	cellular component organization or biogenesis
GO:0016043	0.374	cellular component organization
GO:0001701	0.346	in utero embryonic development
GO:0048518	0.336	positive regulation of biological process
GO:0048522	0.331	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.991	cell periphery
GO:0043227	0.991	membrane-bounded organelle
GO:0062023	0.957	collagen-containing extracellular matrix
GO:0005615	0.951	extracellular space
GO:0031982	0.937	vesicle
GO:1903561	0.847	extracellular vesicle
GO:0012505	0.828	endomembrane system
GO:0005622	0.756	intracellular anatomical structure
GO:0043229	0.754	intracellular organelle
GO:0043231	0.638	intracellular membrane-bounded organelle
GO:0070013	0.524	intracellular organelle lumen
GO:0005737	0.506	cytoplasm
GO:0070062	0.488	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.961	Metalloendopeptidases.

[back to server]