StarFunc result for job id O15078

User Input

>input (2479 residues)
MPPNINWKEIMKVDPDDLPRQEELADNLLISLSKVEVNELKSEKQENVIHLFRITQSLMK
MKAQEVELALEEVEKAGEEQAKFENQLKTKVMKLENELEMAQQSAGGRDTRFLRNEICQL
EKQLEQKDRELEDMEKELEKEKKVNEQLALRNEEAENENSKLRRENKRLKKKNEQLCQDI
IDYQKQIDSQKETLLSRRGEDSDYRSQLSKKNYELIQYLDEIQTLTEANEKIEVQNQEMR
KNLEESVQEMEKMTDEYNRMKAIVHQTDNVIDQLKKENDHYQLQVQELTDLLKSKNEEDD
PIMVAVNAKVEEWKLILSSKDDEIIEYQQMLHNLREKLKNAQLDADKSNVMALQQGIQER
DSQIKMLTEQVEQYTKEMEKNTCIIEDLKNELQRNKGASTLSQQTHMKIQSTLDILKEKT
KEAERTAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVVEIKNCKNQIKIRDREIE
ILTKEINKLELKISDFLDENEALRERVGLEPKTMIDLTEFRNSKHLKQQQYRAENQILLK
EIESLEEERLDLKKKIRQMAQERGKRSATSGLTTEDLNLTENISQGDRISERKLDLLSLK
NMSEAQSKNEFLSRELIEKERDLERSRTVIAKFQNKLKELVEENKQLEEGMKEILQAIKE
MQKDPDVKGGETSLIIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELR
ESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASIINSQ
NEYLIHLLQELENKEKKLKNLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKETWKTESKTI
KEEKRKLEDQVQQDAIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQY
TTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLS
ELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEK
LHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMY
EHLRTSLKQMEERNFELETKFAELTKINLDAQKVEQMLRDELADSVSKAVSDADRQRILE
LEKNEMELKVEVSKLREISDIARRQVEILNAQQQSRDKEVESLRMQLLDYQAQSDEKSLI
AKLHQHNVSLQLSEATALGKLESITSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNRA
KHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLE
MELKLKGLEELISTLKDTKGAQKVINWHMKIEELRLQELKLNRELVKDKEEIKYLNNIIS
EYERTISSLEEEIVQQNKFHEERQMAWDQREVDLERQLDIFDRQQNEILNAAQKFEEATG
SIPDPSLPLPNQLEIALRKIKENIRIILETRATCKSLEEKLKEKESALRLAEQNILSRDK
VINELRLRLPATAEREKLIAELGRKEMEPKSHHTLKIAHQTIANMQARLNQKEEVLKKYQ
RLLEKAREEQREIVKKHEEDLHILHHRLELQADSSLNKFKQTAWDLMKQSPTPVPTNKHF
IRLAEMEQTVAEQDDSLSSLLVKLKKVSQDLERQREITELKVKEFENIKLQLQENHEDEV
KKVKAEVEDLKYLLDQSQKESQCLKSELQAQKEANSRAPTTTMRNLVERLKSQLALKEKQ
QKALSRALLELRAEMTAAAEERIISATSQKEAHLNVQQIVDRHTRELKTQVEDLNENLLK
LKEALKTSKNRENSLTDNLNDLNNELQKKQKAYNKILREKEEIDQENDELKRQIKRLTSG
LQGKPLTDNKQSLIEELQRKVKKLENQLEGKVEEVDLKPMKEKNAKEELIRWEEGKKWQA
KIEGIRNKLKEKEGEVFTLTKQLNTLKDLFAKADKEKLTLQRKLKTTGMTVDQVLGIRAL
ESEKELEELKKRNLDLENDILYMRAHQALPRDSVVEDLHLQNRYLQEKLHALEKQFSKDT
YSKPSISGIESDDHCQREQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVRDLKEMC
EFLKKEKAEVQRKLGHVRGSGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTS
EKMANIEQENEKLKAELEKLKAHLGHQLSMHYESKTKGTEKIIAENERLRKELKKETDAA
EKLRIAKNNLEILNEKMTVQLEETGKRLQFAESRGPQLEGADSKSWKSIVVTRMYETKLK
ELETDIAKKNQSITDLKQLVKEATEREQKVNKYNEDLEQQIKILKHVPEGAETEQGLKRE
LQVLRLANHQLDKEKAELIHQIEANKDQSGAESTIPDADQLKEKIKDLETQLKMSDLEKQ
HLKEEIKKLKKELENFDPSFFEEIEDLKYNYKEEVKKNILLEEKVKKLSEQLGVELTSPV
AASEEFEDEEESPVNFPIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15078	1.000	1.000	0.000	2479	1.000	1.000	O15078.pdb.gz	CE290_HUMAN Centrosomal protein of 290 kDa OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2
2	AFDB:P85001	0.085	0.086	0.000	2439	0.573	0.582	P85001.pdb.gz	CE290_DANRE Centrosomal protein of 290 kDa OS=Danio rerio OX=7955 GN=cep290 PE=2 SV=1
3	AFDB:Q6A078	0.125	0.124	0.000	2472	0.871	0.873	Q6A078.pdb.gz	CE290_MOUSE Centrosomal protein of 290 kDa OS=Mus musculus OX=10090 GN=Cep290 PE=1 SV=2
4	AFDB:Q9TU23	0.088	0.124	1.451E-99	1468	0.524	0.884	Q9TU23.pdb.gz	CE290_BOVIN Centrosomal protein of 290 kDa (Fragment) OS=Bos taurus OX=9913 GN=CEP290 PE=1 SV=2
5	AFDB:S4R322	0.057	0.134	3.620E-58	857	0.332	0.960	S4R322.pdb.gz	S4R322_HUMAN Centrosomal protein 290 (Fragment) OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=1
6	AFDB:Q9W0M1	0.059	0.067	4.870E-6	1978	0.146	0.183	Q9W0M1.pdb.gz	CE290_DROME Centrosomal protein Cep290 OS=Drosophila melanogaster OX=7227 GN=Cep290 PE=1 SV=2
7	AFDB:Q54BP1	0.049	0.055	1.818E-3	2110	0.121	0.142	Q54BP1.pdb.gz	Q54BP1_DICDI Centrosomal protein 248 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293544 PE=4 SV=1
8	AFDB:Q38BI3	0.054	0.053	7.991E-3	2539	0.171	0.167	Q38BI3.pdb.gz	Q38BI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3090 PE=4 SV=1
9	AFDB:Q55BH2	0.040	0.062	1.032E-2	1505	0.071	0.117	Q55BH2.pdb.gz	Q55BH2_DICDI C2 calcium/lipid-binding region-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271334 PE=4 SV=1
10	AFDB:Q92351	0.053	0.103	1.032E-2	1208	0.084	0.172	Q92351.pdb.gz	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
11	PDB:6z6oC	0.049	0.178	2.685E-1	548	0.011	0.049	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
12	PDB:6sueA	0.026	0.028	4.956E-1	2292	0.013	0.014	6sueA.pdb.gz
13	PDB:7myoB	0.044	0.261	5.488E-1	286	0.008	0.066	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
14	PDB:6ikoA	0.045	0.244	5.776E-1	303	0.011	0.092	6ikoA.pdb.gz
15	PDB:7rroA0	0.050	0.350	8.689E-1	221	0.010	0.113	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:5lkiA	0.027	0.042	1.376	1427	0.013	0.022	5lkiA.pdb.gz
17	PDB:4o9yA	0.029	0.029	1.448	2490	0.008	0.008	4o9yA.pdb.gz
18	PDB:5nugA	0.027	0.025	1.604	2920	0.008	0.007	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
19	PDB:6tpiA	0.046	0.214	1.604	380	0.014	0.089	6tpiA.pdb.gz
20	PDB:7vgfA	0.041	0.133	1.604	550	0.008	0.036	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K715	0.0	4217	2479	0.875	0.875	A0A0G2K715_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
2	A0A0G2K929	0.0	1025	2756	0.215	0.193	A0A0G2K929_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
3	A0A5F9ZHU6	0.0	4806	2438	0.983	1.000	A0A5F9ZHU6_HUMAN Centrosomal protein 290 OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2
4	A0A8I5ZYJ8	0.0	4180	2503	0.872	0.863	A0A8I5ZYJ8_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
5	J3KNF5	0.0	4903	2482	1.000	0.999	J3KNF5_HUMAN Centrosomal protein 290 OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2
6	O15078	0.0	4907	2479	1.000	1.000	CE290_HUMAN Centrosomal protein of 290 kDa OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2
7	P85001	0.0	2634	2439	0.574	0.583	CE290_DANRE Centrosomal protein of 290 kDa OS=Danio rerio OX=7955 GN=cep290 PE=2 SV=1
8	Q6A078	0.0	4183	2472	0.871	0.874	CE290_MOUSE Centrosomal protein of 290 kDa OS=Mus musculus OX=10090 GN=Cep290 PE=1 SV=2
9	Q9TU23	0.0	2374	1468	0.503	0.849	CE290_BOVIN Centrosomal protein of 290 kDa (Fragment) OS=Bos taurus OX=9913 GN=CEP290 PE=1 SV=2
10	S4R322	0.0	1620	857	0.333	0.963	S4R322_HUMAN Centrosomal protein 290 (Fragment) OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=1
11	Q9W0M1	0.002	46.6	1978	0.042	0.053	CE290_DROME Centrosomal protein Cep290 OS=Drosophila melanogaster OX=7227 GN=Cep290 PE=1 SV=2
12	A0A087WPM2	0.34	38.9	1184	0.023	0.047	A0A087WPM2_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
13	B8QI36	0.39	38.5	1187	0.023	0.047	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
14	Q69ZW5	0.44	38.5	1140	0.021	0.045	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
15	P70403	1.4	36.6	678	0.012	0.043	CASP_MOUSE Protein CASP OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=2
16	Q13948	1.9	36.2	678	0.014	0.052	CASP_HUMAN Protein CASP OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=2
17	Q5B424	2.1	36.2	2404	0.010	0.011	Q5B424_EMENI Myosin II homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04706 PE=3 SV=1
18	P53564	3.2	35.8	1515	0.012	0.019	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
19	Q9FLR5	3.3	35.4	1058	0.022	0.051	SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana OX=3702 GN=SMC6A PE=2 SV=1
20	Q5T1M5	4.0	35.4	1219	0.011	0.022	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16574 CEP209_CC5	8.2e-46	166.7	Coiled-coil region of centrosome protein CE290

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448012

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367766	0.999	X-linked retinitis pigmentosa GTPase regulator
2	9606.ENSP00000311505	0.998	IQ calmodulin-binding motif-containing protein 1
3	9606.ENSP00000370803	0.997	Centriolar coiled-coil protein of 110 kDa
4	9606.ENSP00000403465	0.996	Coiled-coil and C2 domain-containing protein 2A
5	9606.ENSP00000356774	0.987	Jouberin
6	9606.ENSP00000389998	0.985	Meckelin
7	9606.ENSP00000376827	0.976	Meckel syndrome type 1 protein
8	9606.ENSP00000300935	0.973	Ras-related protein Rab-8A
9	9606.ENSP00000369257	0.971	Protein fantom
10	9606.ENSP00000440638	0.968	Transmembrane protein 216
11	9606.ENSP00000261499	0.964	B9 domain-containing protein 1
12	9606.ENSP00000342510	0.964	Centrosomal protein of 97 kDa
13	9606.ENSP00000268057	0.956	Bardet-Biedl syndrome 4 protein
14	9606.ENSP00000304941	0.952	Tectonic-2
15	9606.ENSP00000380779	0.949	Tectonic-1
16	9606.ENSP00000313169	0.940	Nephrocystin-1
17	9606.ENSP00000243578	0.935	B9 domain-containing protein 2
18	9606.ENSP00000258173	0.926	Transmembrane protein 231
19	9606.ENSP00000367398	0.914	Nephrocystin-4
20	9606.ENSP00000246062	0.905	McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.994	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006996	0.982	organelle organization
GO:0044782	0.973	cilium organization
GO:0065007	0.959	biological regulation
GO:0060271	0.957	cilium assembly
GO:0050794	0.947	regulation of cellular process
GO:0048518	0.779	positive regulation of biological process
GO:0048522	0.704	positive regulation of cellular process
GO:0019222	0.686	regulation of metabolic process
GO:0080090	0.683	regulation of primary metabolic process
GO:0051171	0.679	regulation of nitrogen compound metabolic process
GO:0060255	0.677	regulation of macromolecule metabolic process
GO:0031323	0.673	regulation of cellular metabolic process
GO:0051179	0.669	localization
GO:0070201	0.657	regulation of establishment of protein localization
GO:1904951	0.623	positive regulation of establishment of protein localization
GO:0051050	0.532	positive regulation of transport
GO:0019219	0.469	regulation of nucleobase-containing compound metabolic process
GO:0032386	0.431	regulation of intracellular transport
GO:0032501	0.427	multicellular organismal process
GO:0009893	0.416	positive regulation of metabolic process
GO:0031325	0.387	positive regulation of cellular metabolic process
GO:0010468	0.336	regulation of gene expression
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0010604	0.335	positive regulation of macromolecule metabolic process
GO:0031326	0.329	regulation of cellular biosynthetic process
GO:0010556	0.325	regulation of macromolecule biosynthetic process
GO:0006355	0.319	regulation of DNA-templated transcription
GO:0090316	0.305	positive regulation of intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	0.997	microtubule organizing center
GO:0005813	0.988	centrosome
GO:0043227	0.966	membrane-bounded organelle
GO:0120025	0.936	plasma membrane bounded cell projection
GO:0005829	0.923	cytosol
GO:0005929	0.832	cilium
GO:0012505	0.453	endomembrane system
GO:0032991	0.437	protein-containing complex
GO:0034451	0.391	centriolar satellite
GO:0035869	0.388	ciliary transition zone
GO:0031410	0.387	cytoplasmic vesicle
GO:0034774	0.367	secretory granule lumen
GO:0005576	0.366	extracellular region
GO:0035580	0.364	specific granule lumen
GO:0005814	0.349	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]