StarFunc result for job id O15083

User Input

>input (957 residues)
MYGSARTITNLEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSG
PMYLSDHEGVASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQ
HGGLTGSSHHHHHQVPSMLRQVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMN
SIKTFWSPELKKERVLRKEEAARMSVLKEQMRVSHEENQHLQLTIQALQDELRTQRDLNH
LLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIETQKQTLNA
RDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKENIHLREEL
HRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIK
QIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTA
KEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERK
INVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERL
KEQRERDDRERLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAGLKR
DSKLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPEFADQIKQLDKEASYYRDECG
KAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKHNQQLEKKKNA
QLLEEVRRREDSMADNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANL
RIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQ
LKQQTQNRMKLMADNYDDDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15083	1.000	1.000	0.000	957	1.000	1.000	O15083.pdb.gz	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
2	AFDB:Q811U3	0.263	0.265	1.478E-72	948	0.728	0.735	Q811U3.pdb.gz	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
3	AFDB:Q99MI1	0.179	0.154	1.225E-70	1120	0.718	0.613	Q99MI1.pdb.gz	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
4	AFDB:O44490	0.162	0.181	3.342E-12	836	0.226	0.258	O44490.pdb.gz	O44490_CAEEL ELKS/RAB6-interacting/CAST family member 2 OS=Caenorhabditis elegans OX=6239 GN=elks-1 PE=1 SV=2
5	AFDB:Q9US03	0.080	0.090	1.473E-5	817	0.090	0.105	Q9US03.pdb.gz	KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp2 PE=3 SV=1
6	AFDB:Q91YU6	0.080	0.110	1.570E-5	671	0.106	0.151	Q91YU6.pdb.gz	LZTS2_MOUSE Leucine zipper putative tumor suppressor 2 OS=Mus musculus OX=10090 GN=Lzts2 PE=1 SV=3
7	AFDB:Q9P0K7	0.104	0.102	2.032E-4	980	0.117	0.114	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
8	AFDB:P28739	0.055	0.068	2.463E-4	770	0.090	0.112	P28739.pdb.gz	KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=klpA PE=2 SV=3
9	AFDB:Q7M3S9	0.057	0.058	2.984E-4	943	0.078	0.080	Q7M3S9.pdb.gz	RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum OX=44689 GN=rngB PE=2 SV=2
10	AFDB:Q9CZX2	0.110	0.129	5.309E-4	791	0.133	0.161	Q9CZX2.pdb.gz	CEP89_MOUSE Centrosomal protein of 89 kDa OS=Mus musculus OX=10090 GN=Cep89 PE=1 SV=1
11	PDB:6r1mB	0.062	0.124	3.804E-1	428	0.013	0.028	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
12	PDB:7qenB	0.062	0.126	8.743E-1	419	0.015	0.033	7qenB.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
13	PDB:6tuyA	0.064	0.087	1.129	667	0.015	0.021	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
14	PDB:3zjcE	0.052	0.154	1.885	286	0.015	0.049	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
15	PDB:2zdiB	0.062	0.325	2.142	106	0.009	0.085	2zdiB.pdb.gz
16	PDB:3lssA	0.057	0.107	2.284	438	0.011	0.025	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
17	PDB:7vrcC	0.071	0.573	2.284	109	0.007	0.064	7vrcC.pdb.gz
18	PDB:7rroB0	0.100	0.378	2.435	189	0.024	0.122	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7z37DP1	0.082	0.266	2.767	273	0.019	0.066	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
20	PDB:7ungC4	0.058	0.188	2.950	219	0.013	0.055	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15083	0.0	1922	957	1.000	1.000	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
2	Q6PH08	0.0	1909	957	0.991	0.991	ERC2_MOUSE ERC protein 2 OS=Mus musculus OX=10090 GN=Erc2 PE=1 SV=2
3	Q811U3	0.0	1305	948	0.727	0.734	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
4	Q8IUD2	0.0	1242	1116	0.718	0.616	RB6I2_HUMAN ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1
5	Q8K3M6	0.0	1900	957	0.990	0.990	ERC2_RAT ERC protein 2 OS=Rattus norvegicus OX=10116 GN=Erc2 PE=1 SV=1
6	Q99MI1	0.0	1263	1120	0.718	0.613	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
7	A8DY79	1.27e-34	146	1786	0.108	0.058	A8DY79_DROME Bruchpilot, isoform G OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=2
8	A0A0B4KF38	1.43e-34	145	1498	0.108	0.069	A0A0B4KF38_DROME Bruchpilot, isoform M OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
9	A0A0B4K7K9	1.67e-34	145	2238	0.097	0.042	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
10	A1Z7V1	2.48e-34	145	1740	0.108	0.059	A1Z7V1_DROME Bruchpilot, isoform D OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
11	Q25B55	3.08e-34	145	1740	0.094	0.052	Q25B55_DROME CAST OS=Drosophila melanogaster OX=7227 GN=brp PE=2 SV=1
12	A0A0B4K7V8	1.51e-32	139	1707	0.107	0.060	A0A0B4K7V8_DROME Bruchpilot, isoform K OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
13	A0A0B4K6V0	2.07e-32	139	1781	0.107	0.057	A0A0B4K6V0_DROME Bruchpilot, isoform L OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
14	O44490	7.85e-31	132	836	0.181	0.207	O44490_CAEEL ELKS/RAB6-interacting/CAST family member 2 OS=Caenorhabditis elegans OX=6239 GN=elks-1 PE=1 SV=2
15	A0A0B4K843	8.76e-31	133	1397	0.096	0.066	A0A0B4K843_DROME Bruchpilot, isoform I OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
16	G8IHU0	6.68e-12	72.4	3078	0.129	0.040	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
17	P24043	6.35e-09	62.8	3122	0.126	0.039	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
18	Q9Z0R6	5.84e-04	46.6	1659	0.042	0.024	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
19	P50090	0.011	42.0	882	0.061	0.066	KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KEL2 PE=1 SV=1
20	D4ABD7	0.024	41.2	1973	0.059	0.028	D4ABD7_RAT Thyroid hormone receptor interactor 11 OS=Rattus norvegicus OX=10116 GN=Trip11 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	2.3	18.5	AAA domain
2	PF08614 ATG16	2	20.1	Autophagy protein 16 (ATG16)
3	PF10174 Cast	0	1277.6	RIM-binding protein of the cytomatrix active zone
4	PF19220 Crescentin	2.3	18.8	Crescentin protein
5	PF15619 Lebercilin	19	16.4	Ciliary protein causing Leber congenital amaurosis disease
6	PF16808 PKcGMP_CC	4.7	18.3	Coiled-coil N-terminus of cGMP-dependent protein kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428417	0.897	Regulating synaptic membrane exocytosis protein 1
2	9606.ENSP00000446093	0.893	Gamma-tubulin complex component 2
3	9606.ENSP00000296452	0.887	Protein bassoon
4	9606.ENSP00000335614	0.879	Liprin-alpha-3
5	9606.ENSP00000253925	0.870	Liprin-alpha-1
6	9606.ENSP00000334319	0.808	Protein piccolo
7	9606.ENSP00000261965	0.790	Gamma-tubulin complex component 3
8	9606.ENSP00000450337	0.789	Liprin-alpha-2
9	9606.ENSP00000429562	0.788	Protein unc-13 homolog A
10	9606.ENSP00000352572	0.766	Pericentrin
11	9606.ENSP00000367756	0.758	Protein unc-13 homolog B
12	9606.ENSP00000272198	0.752	Liprin-alpha-4
13	9606.ENSP00000262231	0.735	Regulating synaptic membrane exocytosis protein 2
14	9606.ENSP00000259870	0.710	Uncharacterized protein C6orf15
15	9606.ENSP00000386520	0.698	Helicase ARIP4
16	9606.ENSP00000263925	0.660	E3 ubiquitin-protein ligase LNX
17	9606.ENSP00000293872	0.659	Putative RNA-binding protein Luc7-like 1
18	9606.ENSP00000378338	0.655	ARF GTPase-activating protein GIT1
19	9606.ENSP00000260130	0.651	Syntenin-1
20	9606.ENSP00000251413	0.650	Tubulin gamma-1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0007154	0.979	cell communication
GO:0023052	0.961	signaling
GO:0007267	0.941	cell-cell signaling
GO:0071840	0.937	cellular component organization or biogenesis
GO:0099536	0.934	synaptic signaling
GO:0006810	0.927	transport
GO:0016043	0.915	cellular component organization
GO:0016192	0.907	vesicle-mediated transport
GO:0007268	0.903	chemical synaptic transmission
GO:0006836	0.875	neurotransmitter transport
GO:0051049	0.866	regulation of transport
GO:0051649	0.866	establishment of localization in cell
GO:0065008	0.865	regulation of biological quality
GO:0032940	0.862	secretion by cell
GO:0001505	0.839	regulation of neurotransmitter levels
GO:0051128	0.824	regulation of cellular component organization
GO:0099643	0.793	signal release from synapse
GO:0007269	0.762	neurotransmitter secretion
GO:0050808	0.761	synapse organization
GO:0006887	0.742	exocytosis
GO:0033043	0.706	regulation of organelle organization
GO:0031338	0.699	regulation of vesicle fusion
GO:0099003	0.549	vesicle-mediated transport in synapse
GO:0042592	0.501	homeostatic process
GO:0045055	0.437	regulated exocytosis
GO:0099504	0.427	synaptic vesicle cycle
GO:0140029	0.371	exocytic process
GO:0019725	0.328	cellular homeostasis
GO:0030003	0.317	intracellular monoatomic cation homeostasis
GO:0051480	0.307	regulation of cytosolic calcium ion concentration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.991	cytoplasm
GO:0098793	0.991	presynapse
GO:0071944	0.990	cell periphery
GO:0048786	0.982	presynaptic active zone
GO:0016020	0.978	membrane
GO:0043226	0.966	organelle
GO:0005886	0.958	plasma membrane
GO:0043227	0.952	membrane-bounded organelle
GO:0043229	0.948	intracellular organelle
GO:0098831	0.902	presynaptic active zone cytoplasmic component
GO:0005829	0.886	cytosol
GO:0043231	0.875	intracellular membrane-bounded organelle
GO:0031982	0.717	vesicle
GO:0012505	0.654	endomembrane system
GO:0032991	0.554	protein-containing complex
GO:0031410	0.409	cytoplasmic vesicle
GO:0043232	0.329	intracellular non-membrane-bounded organelle
GO:0030425	0.316	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]