StarFunc result for job id O15084

User Input

>input (1053 residues)
MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELL
ILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAV
KCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWA
AYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGN
TPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN
MKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLIT
SGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLEC
LNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAAT
SDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTD
MLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVD
VLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLS
VLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGR
TPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV
FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQ
LLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSK
GHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGY
TPALACAPNKDVADCLALILATMMPVSSSSPLSSLTFNAINRYTNTSKTVSFEALPIMRN
EPSSYCSFNNIGGEQEYLYTDVDELNDSDSETY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15084	1.000	1.000	0.000	1053	1.000	1.000	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
2	AFDB:Q8N8A2	0.820	0.866	2.930E-98	993	0.649	0.688	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
3	AFDB:Q8NB46	0.745	0.730	3.758E-97	1076	0.594	0.582	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
4	AFDB:Q9VMR4	0.596	0.369	5.696E-48	1761	0.276	0.165	Q9VMR4.pdb.gz	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
5	AFDB:G5E8K5	0.419	0.246	5.104E-44	1961	0.255	0.137	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
6	AFDB:Q9NCP8	0.350	0.322	5.508E-44	1159	0.248	0.225	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	AFDB:A0A0G2K916	0.508	0.244	1.052E-43	2615	0.264	0.106	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
8	AFDB:P16157	0.486	0.288	2.010E-43	1881	0.255	0.142	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
9	AFDB:O70511	0.418	0.191	2.432E-43	2622	0.251	0.101	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
10	AFDB:O75179	0.629	0.280	3.840E-43	2603	0.264	0.107	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
11	PDB:8cs9A	0.453	0.573	8.083E-42	796	0.251	0.332	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.463	0.341	1.949E-37	1499	0.235	0.165	5vkqA.pdb.gz
13	PDB:4oauC	0.168	0.224	1.245E-12	692	0.093	0.142	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.198	0.855	6.664E-10	229	0.069	0.319	2dvwA.pdb.gz
15	PDB:6aunA	0.219	0.358	6.301E-9	618	0.071	0.121	6aunA.pdb.gz
16	PDB:6v9hC	0.195	0.720	2.214E-8	270	0.075	0.293	6v9hC.pdb.gz
17	PDB:1wg0A	0.188	0.759	1.055E-7	243	0.054	0.235	1wg0A.pdb.gz
18	PDB:6pqpA	0.172	0.283	2.949E-7	615	0.085	0.146	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.156	0.805	5.220E-7	192	0.049	0.271	6jd6B.pdb.gz
20	PDB:6mwqA	0.140	0.292	1.700E-6	493	0.088	0.189	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15084	0.0	2165	1053	1.000	1.000	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
2	Q8N8A2	0.0	1373	993	0.648	0.687	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
3	Q8NB46	0.0	1260	1076	0.600	0.587	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
4	A0A5F9ZHR8	5.41e-89	317	3939	0.236	0.063	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
5	I6L894	5.51e-89	317	3924	0.239	0.064	I6L894_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
6	A0A5F9ZHS1	5.53e-89	317	3984	0.236	0.062	A0A5F9ZHS1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
7	Q01484	5.67e-89	317	3957	0.239	0.064	ANK2_HUMAN Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4
8	A0A5F9ZGX3	5.95e-89	317	3972	0.236	0.062	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZHN5	5.97e-89	317	3903	0.236	0.064	A0A5F9ZHN5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZHE4	6.00e-89	317	3964	0.236	0.063	A0A5F9ZHE4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZI40	6.14e-89	317	3915	0.236	0.063	A0A5F9ZI40_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZGY3	6.15e-89	317	3934	0.236	0.063	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHD2	6.15e-89	317	3936	0.236	0.063	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	D6RHE1	6.17e-89	317	3961	0.236	0.063	D6RHE1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=2
15	A0A5F9ZH30	6.18e-89	317	3995	0.236	0.062	A0A5F9ZH30_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZI46	1.16e-88	316	3882	0.236	0.064	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI30	1.19e-88	316	3820	0.236	0.065	A0A5F9ZI30_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZI65	1.20e-88	316	3879	0.236	0.064	A0A5F9ZI65_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHT4	1.21e-88	316	3870	0.236	0.064	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHT8	1.25e-88	316	3891	0.239	0.065	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-137	454.2	Ankyrin repeat
2	PF12796 Ank_2	5.8e-160	531.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-112	364.0	Ankyrin repeat
4	PF13637 Ank_4	6.5e-151	500.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	7.7e-115	384.8	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392147	0.977	Protein phosphatase 6 catalytic subunit
2	9606.ENSP00000377390	0.951	Serine/threonine-protein phosphatase 6 regulatory subunit 3
3	9606.ENSP00000414202	0.948	Serine/threonine-protein phosphatase 6 regulatory subunit 1
4	9606.ENSP00000280333	0.926	Dedicator of cytokinesis protein 1
5	9606.ENSP00000478417	0.911	Serine/threonine-protein phosphatase 6 regulatory subunit 2
6	9606.ENSP00000381823	0.908	Protein transport protein Sec24A
7	9606.ENSP00000428564	0.908	Protein transport protein Sec24B
8	9606.ENSP00000226796	0.902	H/ACA ribonucleoprotein complex subunit 1
9	9606.ENSP00000280551	0.902	Protein transport protein Sec24D
10	9606.ENSP00000309572	0.902	Telomerase reverse transcriptase
11	9606.ENSP00000343405	0.902	Protein transport protein Sec24C
12	9606.ENSP00000358563	0.902	H/ACA ribonucleoprotein complex subunit 4
13	9606.ENSP00000254942	0.900	Telomeric repeat-binding factor 2
14	9606.ENSP00000267415	0.900	TERF1-interacting nuclear factor 2
15	9606.ENSP00000274606	0.900	H/ACA ribonucleoprotein complex subunit 2
16	9606.ENSP00000276603	0.900	Telomeric repeat-binding factor 1
17	9606.ENSP00000300086	0.900	Telomeric repeat-binding factor 2-interacting protein 1
18	9606.ENSP00000324203	0.900	Telomerase Cajal body protein 1
19	9606.ENSP00000332198	0.900	H/ACA ribonucleoprotein complex subunit 3
20	9606.ENSP00000350249	0.900	Protection of telomeres protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.981	biological regulation
GO:0050789	0.960	regulation of biological process
GO:0050794	0.866	regulation of cellular process
GO:0071840	0.448	cellular component organization or biogenesis
GO:0016043	0.442	cellular component organization
GO:0048518	0.436	positive regulation of biological process
GO:0008152	0.397	metabolic process
GO:0071704	0.360	organic substance metabolic process
GO:0019222	0.358	regulation of metabolic process
GO:0060255	0.341	regulation of macromolecule metabolic process
GO:0051179	0.323	localization
GO:0043170	0.302	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005829	0.987	cytosol
GO:0016020	0.601	membrane
GO:0032991	0.478	protein-containing complex
GO:0071944	0.420	cell periphery
GO:0005886	0.412	plasma membrane
GO:0043232	0.329	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]