StarFunc result for job id O15085

User Input

>input (1522 residues)
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15085	0.999	0.999	0.000	1522	1.000	1.000	O15085.pdb.gz	ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1
2	AFDB:Q68FM7	0.425	0.418	0.000	1552	0.846	0.830	Q68FM7.pdb.gz	Q68FM7_MOUSE Rho guanine nucleotide exchange factor (GEF) 11 OS=Mus musculus OX=10090 GN=Arhgef11 PE=1 SV=1
3	AFDB:Q9ES67	0.498	0.497	0.000	1527	0.835	0.832	Q9ES67.pdb.gz	ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus OX=10116 GN=Arhgef11 PE=1 SV=1
4	AFDB:A1ZAN6	0.240	0.148	9.207E-44	2559	0.296	0.176	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
5	AFDB:F1QCK8	0.224	0.332	1.983E-22	1012	0.121	0.182	F1QCK8.pdb.gz	F1QCK8_DANRE Rho guanine nucleotide exchange factor 18 isoform X2 OS=Danio rerio OX=7955 GN=arhgef18b PE=1 SV=2
6	AFDB:E9Q7D5	0.199	0.192	1.269E-14	1581	0.106	0.102	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
7	PDB:7rx9A	0.119	0.402	4.279E-14	432	0.048	0.169	7rx9A.pdb.gz
8	AFDB:Q12774	0.196	0.187	1.633E-13	1597	0.110	0.105	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
9	PDB:4mt6A	0.169	0.533	3.545E-13	389	0.041	0.162	4mt6A.pdb.gz
10	AFDB:Q5JU85	0.086	0.087	6.054E-12	1488	0.125	0.128	Q5JU85.pdb.gz	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
11	AFDB:Q9VVC6	0.214	0.164	2.707E-11	2029	0.105	0.079	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
12	AFDB:O14924	0.064	0.067	9.079E-9	1447	0.147	0.154	O14924.pdb.gz	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1
13	PDB:4gouA	0.121	0.327	5.928E-8	507	0.028	0.085	4gouA.pdb.gz
14	PDB:7pcbA	0.052	0.187	3.977E-4	415	0.024	0.087	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6t36A	0.052	0.806	4.743E-4	93	0.014	0.237	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:5n7dA	0.053	0.180	7.051E-4	423	0.022	0.080	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
17	PDB:7pc3A	0.052	0.187	7.051E-4	405	0.016	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7pe9I	0.051	0.237	8.409E-4	317	0.015	0.073	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
19	PDB:2xkxA	0.052	0.107	9.598E-4	721	0.016	0.035	2xkxA.pdb.gz
20	PDB:7p73A	0.050	0.177	9.598E-4	420	0.016	0.057	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15085	0.0	3094	1522	1.000	1.000	ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1
2	Q68FM7	0.0	2398	1552	0.848	0.831	Q68FM7_MOUSE Rho guanine nucleotide exchange factor (GEF) 11 OS=Mus musculus OX=10090 GN=Arhgef11 PE=1 SV=1
3	Q9ES67	0.0	2419	1527	0.838	0.835	ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus OX=10116 GN=Arhgef11 PE=1 SV=1
4	Q7TQK9	6.66e-156	479	378	0.177	0.714	Q7TQK9_MOUSE Arhgef11 protein (Fragment) OS=Mus musculus OX=10090 GN=Arhgef11 PE=2 SV=1
5	M0QZR4	3.77e-133	439	968	0.217	0.341	M0QZR4_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=1
6	Q9NZN5	2.34e-114	398	1544	0.136	0.134	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
7	Q8R4H2	8.29e-111	388	1543	0.130	0.128	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
8	Q61210	4.44e-108	368	920	0.142	0.235	ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus OX=10090 GN=Arhgef1 PE=1 SV=2
9	Q92888	1.56e-104	358	912	0.131	0.218	ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=2
10	Q9Z1I6	4.18e-103	354	919	0.140	0.232	ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Arhgef1 PE=2 SV=1
11	G5EFE1	7.03e-73	270	1340	0.105	0.119	G5EFE1_CAEEL Guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=rhgf-1 PE=1 SV=1
12	O44381	3.61e-62	238	2559	0.096	0.057	O44381_DROME Shar pei/DRhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
13	Q8T9E3	3.61e-62	238	2555	0.096	0.057	Q8T9E3_DROME SD04476p OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
14	A0A0B4LFF8	4.09e-62	238	2456	0.096	0.059	A0A0B4LFF8_DROME Rho guanine nucleotide exchange factor 2, isoform H OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
15	A0A0B4K7T7	4.28e-62	238	2557	0.096	0.057	A0A0B4K7T7_DROME Rho guanine nucleotide exchange factor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
16	A1ZAN6	4.59e-62	238	2559	0.096	0.057	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
17	A1ZAN7	5.39e-62	237	2205	0.096	0.066	A1ZAN7_DROME Rho guanine nucleotide exchange factor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
18	O44113	2.11e-61	235	2559	0.095	0.057	O44113_DROME Putative guanine nucleotide exchange factor RhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
19	F6P6M2	6.18e-56	217	1753	0.081	0.070	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
20	Q60875	2.12e-46	184	985	0.072	0.112	ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Arhgef2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	5.2e-11	54.1	PDZ domain
2	PF13180 PDZ_2	0.00042	31.9	PDZ domain
3	PF17820 PDZ_6	5.9e-08	43.8	PDZ domain
4	PF02163 Peptidase_M50	0.13	23.1	Peptidase family M50
5	PF00169 PH	1.4e+02	14.4	PH domain
6	PF16652 PH_13	2.4	19.5	Pleckstrin homology domain
7	PF17838 PH_16	4.9e-46	167.1	PH domain
8	PF00615 RGS	0.0017	30.1	Regulator of G protein signaling domain
9	PF09128 RGS-like	4.2e-69	243.7	Regulator of G protein signalling-like domain
10	PF00621 RhoGEF	5.4e-32	123.0	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000351338	0.998	Plexin-B1
3	9606.ENSP00000285735	0.984	Rho-related GTP-binding protein RhoC
4	9606.ENSP00000400717	0.979	Guanine nucleotide-binding protein subunit alpha-13
5	9606.ENSP00000275364	0.977	Guanine nucleotide-binding protein subunit alpha-12
6	9606.ENSP00000409171	0.968	Plexin-B2
7	9606.ENSP00000272233	0.959	Rho-related GTP-binding protein RhoB
8	9606.ENSP00000469413	0.958	Serine/threonine-protein kinase PAK 4
9	9606.ENSP00000221742	0.919	Excitatory amino acid transporter 4
10	9606.ENSP00000354718	0.875	A-kinase anchor protein 13
11	9606.ENSP00000443256	0.860	Lysophosphatidic acid receptor 2
12	9606.ENSP00000380942	0.851	Rho guanine nucleotide exchange factor 12
13	9606.ENSP00000382697	0.846	Rho-associated protein kinase 1
14	9606.ENSP00000337261	0.834	Rho guanine nucleotide exchange factor 1
15	9606.ENSP00000317985	0.831	Rho-associated protein kinase 2
16	9606.ENSP00000378557	0.813	Disheveled-associated activator of morphogenesis 1
17	9606.ENSP00000442736	0.801	Plexin-B3
18	9606.ENSP00000416523	0.800	Semaphorin-4D
19	9606.ENSP00000298694	0.791	Rho guanine nucleotide exchange factor 40
20	9606.ENSP00000409581	0.789	Beta-arrestin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030234	0.995	enzyme regulator activity
GO:0140677	0.993	molecular function activator activity
GO:0030695	0.993	GTPase regulator activity
GO:0005085	0.981	guanyl-nucleotide exchange factor activity
GO:0001664	0.942	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0009966	0.936	regulation of signal transduction
GO:0050896	0.934	response to stimulus
GO:1902531	0.900	regulation of intracellular signal transduction
GO:0051716	0.891	cellular response to stimulus
GO:0023052	0.885	signaling
GO:0007165	0.878	signal transduction
GO:0048518	0.846	positive regulation of biological process
GO:0051056	0.842	regulation of small GTPase mediated signal transduction
GO:0048522	0.835	positive regulation of cellular process
GO:0019222	0.607	regulation of metabolic process
GO:0060255	0.579	regulation of macromolecule metabolic process
GO:0051171	0.523	regulation of nitrogen compound metabolic process
GO:0031323	0.517	regulation of cellular metabolic process
GO:0009893	0.516	positive regulation of metabolic process
GO:0080090	0.511	regulation of primary metabolic process
GO:0010604	0.487	positive regulation of macromolecule metabolic process
GO:0035556	0.382	intracellular signal transduction
GO:0071840	0.360	cellular component organization or biogenesis
GO:0007264	0.348	small GTPase mediated signal transduction
GO:0016043	0.342	cellular component organization
GO:0032501	0.329	multicellular organismal process
GO:0007265	0.325	Ras protein signal transduction
GO:0032502	0.311	developmental process
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process
GO:0048856	0.304	anatomical structure development
GO:0007266	0.300	Rho protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0031981	0.995	nuclear lumen
GO:0005654	0.990	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]