StarFunc result for job id O15091

User Input

>input (583 residues)
MTFYLFGIRSFPKLWKSPYLGLGPGHSYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATN
LIAKARYLRKDEGSNKQVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLN
SEEWDKLKEDLKENTGKTSFESWIISQMAGCHSSIDVAKSLLAWVAAKNNGIVSYDLLVK
YLYLCVFHMQTSEVIDVFEIMKARYKTLEPRGYSLLIRGLIHSDRWREALLLLEDIKKVI
TPSKKNYNDCIQGALLHQDVNTAWNLYQELLGHDIVPMLETLKAFFDFGKDIKDDNYSNK
LLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQL
SPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKV
RESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDP
FLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQ
RILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15091	1.000	1.000	2.890E-95	583	1.000	1.000	O15091.pdb.gz	MRPP3_HUMAN Mitochondrial ribonuclease P catalytic subunit OS=Homo sapiens OX=9606 GN=PRORP PE=1 SV=2
2	AFDB:Q8JZY4	0.809	0.808	3.382E-76	584	0.777	0.776	Q8JZY4.pdb.gz	MRPP3_MOUSE Mitochondrial ribonuclease P catalytic subunit OS=Mus musculus OX=10090 GN=Prorp PE=2 SV=1
3	PDB:7onuE	0.634	0.772	5.151E-70	467	0.801	1.000	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.
4	AFDB:Q5U1E0	0.625	0.663	1.140E-31	544	0.237	0.254	Q5U1E0.pdb.gz	Q5U1E0_DROME ribonuclease P OS=Drosophila melanogaster OX=7227 GN=mldr PE=2 SV=1
5	AFDB:F4JKB6	0.525	0.531	9.618E-21	576	0.170	0.172	F4JKB6.pdb.gz	PRRP3_ARATH Proteinaceous RNase P 3 OS=Arabidopsis thaliana OX=3702 GN=PRORP3 PE=1 SV=1
6	PDB:5dizA	0.500	0.595	3.622E-18	474	0.136	0.167	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
7	AFDB:Q386L0	0.494	0.502	5.738E-17	571	0.156	0.159	Q386L0.pdb.gz	Q386L0_TRYB2 ribonuclease P OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0510 PE=3 SV=1
8	AFDB:Q0WLC6	0.281	0.159	2.271E-7	1089	0.091	0.049	Q0WLC6.pdb.gz	PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRL1 PE=1 SV=2
9	AFDB:Q9LS25	0.272	0.228	1.243E-6	711	0.082	0.068	Q9LS25.pdb.gz	PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g46580 PE=2 SV=1
10	AFDB:Q381G1	0.242	0.235	1.924E-6	606	0.110	0.106	Q381G1.pdb.gz	Q381G1_TRYB2 PIN domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7930 PE=4 SV=1
11	AFDB:Q9SR00	0.260	0.253	2.121E-6	602	0.098	0.095	Q9SR00.pdb.gz	PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g04760 PE=2 SV=1
12	AFDB:P0C896	0.255	0.258	2.575E-6	576	0.105	0.106	P0C896.pdb.gz	PP209_ARATH Small ribosomal subunit protein mS80 (rPPR6) OS=Arabidopsis thaliana OX=3702 GN=At3g02650 PE=1 SV=1
13	PDB:7puaFX	0.272	0.629	3.744E-5	220	0.041	0.109	7puaFX.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
14	PDB:4m57A	0.284	0.241	6.086E-5	702	0.069	0.057	4m57A.pdb.gz
15	PDB:7po24	0.272	0.268	1.952E-4	592	0.082	0.081	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:7pnt4	0.276	0.274	2.371E-4	589	0.093	0.092	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:4leuA	0.206	0.549	7.985E-4	182	0.055	0.176	4leuA.pdb.gz
18	PDB:6yxxE6	0.234	0.298	2.963E-3	434	0.058	0.078	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7pubFO	0.260	0.535	4.370E-3	267	0.046	0.101	7pubFO.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:6sgaFA	0.248	0.249	5.056E-3	579	0.072	0.073	6sgaFA.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15091	0.0	1218	583	1.000	1.000	MRPP3_HUMAN Mitochondrial ribonuclease P catalytic subunit OS=Homo sapiens OX=9606 GN=PRORP PE=1 SV=2
2	Q8JZY4	0.0	902	584	0.777	0.776	MRPP3_MOUSE Mitochondrial ribonuclease P catalytic subunit OS=Mus musculus OX=10090 GN=Prorp PE=2 SV=1
3	Q5U1E0	1.09e-52	190	544	0.245	0.263	Q5U1E0_DROME ribonuclease P OS=Drosophila melanogaster OX=7227 GN=mldr PE=2 SV=1
4	Q9W413	1.14e-52	190	544	0.245	0.263	Q9W413_DROME ribonuclease P OS=Drosophila melanogaster OX=7227 GN=mldr PE=2 SV=1
5	Q8SYK6	2.17e-45	166	364	0.182	0.291	Q8SYK6_DROME RE55427p OS=Drosophila melanogaster OX=7227 GN=mldr PE=2 SV=1
6	Q66GI4	1.07e-14	79.3	572	0.201	0.205	PRRP1_ARATH Proteinaceous RNase P 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRORP1 PE=1 SV=1
7	Q38E68	1.64e-05	50.1	566	0.106	0.110	Q38E68_TRYB2 PRORP domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0870 PE=3 SV=1
8	F4JKB6	1.17e-04	47.4	576	0.094	0.095	PRRP3_ARATH Proteinaceous RNase P 3 OS=Arabidopsis thaliana OX=3702 GN=PRORP3 PE=1 SV=1
9	Q680B9	1.28e-04	47.4	528	0.091	0.100	PRRP2_ARATH Proteinaceous RNase P 2 OS=Arabidopsis thaliana OX=3702 GN=PRORP2 PE=1 SV=1
10	Q9LW84	0.005	42.4	642	0.057	0.051	PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana OX=3702 GN=At3g16010 PE=2 SV=1
11	P0C7Q7	0.008	41.6	602	0.069	0.066	PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12700 PE=3 SV=1
12	Q9FIX3	0.013	40.8	747	0.082	0.064	PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana OX=3702 GN=EMB2745 PE=2 SV=1
13	Q9SXD1	0.019	40.4	630	0.051	0.048	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
14	Q9ASZ8	0.039	39.3	621	0.050	0.047	PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1
15	Q0WKV3	0.10	38.1	637	0.045	0.041	PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12300 PE=2 SV=1
16	Q9SI78	0.15	37.4	485	0.050	0.060	PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana OX=3702 GN=At1g62720 PE=2 SV=1
17	Q9SZ52	0.16	37.4	1112	0.043	0.022	PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGR3 PE=1 SV=1
18	P0C896	0.25	36.6	576	0.043	0.043	PP209_ARATH Small ribosomal subunit protein mS80 (rPPR6) OS=Arabidopsis thaliana OX=3702 GN=At3g02650 PE=1 SV=1
19	O49436	0.28	36.6	660	0.055	0.048	PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana OX=3702 GN=EMB1025 PE=3 SV=1
20	Q9LQ14	0.48	35.8	629	0.050	0.046	PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g62930 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11638 DnaA_N	1.2e+02	13.8	DnaA N-terminal domain
2	PF07282 OrfB_Zn_ribbon	3.8e+02	12.4	Putative transposase DNA-binding domain
3	PF01535 PPR	8.1	18.0	PPR repeat
4	PF13041 PPR_2	0.78	21.3	PPR repeat family
5	PF16953 PRORP	5.7e-99	342.1	Protein-only RNase P
6	PF11977 RNase_Zc3h12a	2.7e+02	12.7	Zc3h12a-like Ribonuclease NYN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000168216	0.999	3-hydroxyacyl-CoA dehydrogenase type-2
2	9606.ENSP00000312356	0.996	tRNA methyltransferase 10 homolog C
3	9606.ENSP00000304353	0.955	Ribonuclease P protein subunit p20
4	9606.ENSP00000412894	0.940	Ribonuclease P protein subunit p14
5	9606.ENSP00000465213	0.940	Ribonuclease P protein subunit p29
6	9606.ENSP00000350098	0.937	Ribonuclease P/MRP protein subunit POP5
7	9606.ENSP00000409799	0.936	Ribonuclease P protein subunit p21
8	9606.ENSP00000478982	0.933	Ribonuclease P protein subunit p38
9	9606.ENSP00000317691	0.932	Ribonuclease P protein subunit p25
10	9606.ENSP00000369391	0.929	Ribonuclease P protein subunit p40
11	9606.ENSP00000389182	0.928	Ribonuclease P protein subunit p30
12	9606.ENSP00000385787	0.916	Ribonucleases P/MRP protein subunit POP1
13	9606.ENSP00000437256	0.902	Endoribonuclease Dicer
14	9606.ENSP00000220592	0.900	Protein argonaute-2
15	9606.ENSP00000266987	0.900	RISC-loading complex subunit TARBP2
16	9606.ENSP00000434995	0.900	Polyribonucleotide 5'-hydroxyl-kinase Clp1
17	9606.ENSP00000348460	0.764	Neuronal PAS domain-containing protein 3
18	9606.ENSP00000273962	0.749	tRNA methyltransferase 10 homolog A
19	9606.ENSP00000370013	0.742	Pentatricopeptide repeat-containing protein 2, mitochondrial
20	9606.ENSP00000292478	0.725	Pentatricopeptide repeat-containing protein 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004526	0.999	ribonuclease P activity
GO:0005515	0.665	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0008033	0.991	tRNA processing
GO:0000966	0.979	RNA 5'-end processing
GO:0000963	0.967	mitochondrial RNA processing
GO:0099116	0.373	tRNA 5'-end processing
GO:0065007	0.323	biological regulation
GO:0050789	0.313	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005759	1.000	mitochondrial matrix
GO:0032991	0.999	protein-containing complex
GO:0005654	0.995	nucleoplasm
GO:1990904	0.989	ribonucleoprotein complex
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0140535	0.974	intracellular protein-containing complex
GO:1902494	0.973	catalytic complex
GO:1905348	0.964	endonuclease complex
GO:1902555	0.893	endoribonuclease complex
GO:0098798	0.733	mitochondrial protein-containing complex
GO:0030677	0.682	ribonuclease P complex
GO:0030678	0.476	mitochondrial ribonuclease P complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.26.5	0.999	ribonuclease P.

[back to server]