StarFunc result for job id O15105

User Input

>input (426 residues)
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15105	1.000	1.000	8.305E-85	426	1.000	1.000	O15105.pdb.gz	SMAD7_HUMAN Mothers against decapentaplegic homolog 7 OS=Homo sapiens OX=9606 GN=SMAD7 PE=1 SV=1
2	AFDB:A0A1D5PNY8	0.697	0.762	2.183E-60	388	0.749	0.822	A0A1D5PNY8.pdb.gz	A0A1D5PNY8_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD7 PE=3 SV=1
3	AFDB:C3U1W5	0.670	0.663	2.548E-49	431	0.502	0.497	C3U1W5.pdb.gz	C3U1W5_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=Smad6 PE=2 SV=1
4	AFDB:O43541	0.662	0.572	1.701E-46	496	0.521	0.448	O43541.pdb.gz	SMAD6_HUMAN Mothers against decapentaplegic homolog 6 OS=Homo sapiens OX=9606 GN=SMAD6 PE=1 SV=2
5	AFDB:F1RC55	0.656	0.615	1.823E-43	456	0.441	0.412	F1RC55.pdb.gz
6	AFDB:O15968	0.536	0.413	2.898E-28	568	0.279	0.210	O15968.pdb.gz	O15968_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
7	AFDB:Q1ED26	0.380	0.560	2.741E-27	286	0.256	0.381	Q1ED26.pdb.gz
8	AFDB:Q02330	0.366	0.373	1.206E-25	418	0.225	0.230	Q02330.pdb.gz	SMA2_CAEEL Dwarfin sma-2 OS=Caenorhabditis elegans OX=6239 GN=sma-2 PE=2 SV=2
9	AFDB:Q9I9P9	0.362	0.332	2.759E-25	468	0.246	0.224	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
10	AFDB:K7EIU8	0.338	0.316	1.210E-24	456	0.225	0.211	K7EIU8.pdb.gz	K7EIU8_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1
11	PDB:6z4eA	0.102	0.193	1.632E-1	207	0.019	0.039	6z4eA.pdb.gz
12	PDB:7dvqX	0.174	0.422	2.067E-1	156	0.026	0.071	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:2ff4A	0.128	0.142	6.744E-1	379	0.040	0.045	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
14	PDB:7u05A	0.078	0.037	7.155E-1	1114	0.054	0.021	7u05A.pdb.gz
15	PDB:7d58N	0.057	0.120	8.543E-1	136	0.045	0.140	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
16	PDB:5z56X	0.177	0.416	9.616E-1	159	0.031	0.082	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:4exmC	0.081	0.096	1.020	331	0.028	0.036	4exmC.pdb.gz
18	PDB:7a6hN	0.061	0.098	1.082	186	0.042	0.097	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
19	PDB:7sqcO1	0.067	0.048	1.148	673	0.023	0.015	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:2iglA	0.098	0.271	1.218	116	0.031	0.112	2iglA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PNY8	0.0	546	388	0.737	0.809	A0A1D5PNY8_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD7 PE=3 SV=1
2	C3U1W4	0.0	538	384	0.728	0.807	C3U1W4_CHICK Mothers against decapentaplegic homolog (Fragment) OS=Gallus gallus OX=9031 GN=Smad7a PE=2 SV=1
3	O15105	0.0	873	426	1.000	1.000	SMAD7_HUMAN Mothers against decapentaplegic homolog 7 OS=Homo sapiens OX=9606 GN=SMAD7 PE=1 SV=1
4	O35253	0.0	858	426	0.981	0.981	SMAD7_MOUSE Mothers against decapentaplegic homolog 7 OS=Mus musculus OX=10090 GN=Smad7 PE=1 SV=1
5	O88406	0.0	856	426	0.979	0.979	SMAD7_RAT Mothers against decapentaplegic homolog 7 OS=Rattus norvegicus OX=10116 GN=Smad7 PE=2 SV=2
6	Q9W734	2.21e-129	382	431	0.521	0.515	SMAD6_CHICK Mothers against decapentaplegic homolog 6 OS=Gallus gallus OX=9031 GN=SMAD6 PE=2 SV=1
7	C3U1W5	5.35e-128	378	431	0.512	0.506	C3U1W5_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=Smad6 PE=2 SV=1
8	O43541	1.76e-117	353	496	0.528	0.454	SMAD6_HUMAN Mothers against decapentaplegic homolog 6 OS=Homo sapiens OX=9606 GN=SMAD6 PE=1 SV=2
9	O35182	1.89e-114	346	495	0.519	0.446	SMAD6_MOUSE Mothers against decapentaplegic homolog 6 OS=Mus musculus OX=10090 GN=Smad6 PE=1 SV=1
10	D3ZAQ2	6.44e-113	342	495	0.427	0.368	D3ZAQ2_RAT Mothers against decapentaplegic homolog OS=Rattus norvegicus OX=10116 GN=Smad6 PE=3 SV=4
11	A2VCX3	8.26e-65	209	233	0.268	0.489	A2VCX3_DANRE Smad6a protein (Fragment) OS=Danio rerio OX=7955 GN=smad6a PE=2 SV=1
12	Q8SZT4	4.10e-40	152	507	0.293	0.247	Q8SZT4_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
13	Q5U110	7.67e-40	152	568	0.293	0.220	Q5U110_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
14	A0A6H2EEY2	1.47e-39	152	665	0.293	0.188	A0A6H2EEY2_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=3 SV=1
15	O15968	4.04e-39	150	568	0.291	0.218	O15968_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
16	Q8AY16	2.03e-29	120	423	0.244	0.246	Q8AY16_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zgc:92234 PE=2 SV=1
17	P84022	2.49e-29	120	425	0.235	0.235	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
18	P84025	2.49e-29	120	425	0.235	0.235	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
19	Q8BUN5	2.49e-29	120	425	0.235	0.235	SMAD3_MOUSE Mothers against decapentaplegic homolog 3 OS=Mus musculus OX=10090 GN=Smad3 PE=1 SV=2
20	P84023	2.59e-28	117	426	0.239	0.239	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03165 MH1	4.3e-27	105.7	MH1 domain
2	PF03166 MH2	5e-47	171.9	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262435	0.999	E3 ubiquitin-protein ligase SMURF2
2	9606.ENSP00000354621	0.999	E3 ubiquitin-protein ligase SMURF1
3	9606.ENSP00000364133	0.999	TGF-beta receptor type-1
4	9606.ENSP00000383199	0.999	E3 ubiquitin-protein ligase NEDD4-like
5	9606.ENSP00000453872	0.999	E3 ubiquitin-protein ligase Arkadia
6	9606.ENSP00000478927	0.999	Transcriptional coactivator YAP1
7	9606.ENSP00000200453	0.998	Protein phosphatase 1 regulatory subunit 15A
8	9606.ENSP00000262320	0.998	Axin-1
9	9606.ENSP00000344456	0.998	Catenin beta-1
10	9606.ENSP00000427793	0.995	NEDD4-like E3 ubiquitin-protein ligase WWP1
11	9606.ENSP00000351905	0.994	TGF-beta receptor type-2
12	9606.ENSP00000356425	0.993	Ubiquitin carboxyl-terminal hydrolase isozyme L5
13	9606.ENSP00000341551	0.992	Mothers against decapentaplegic homolog 4
14	9606.ENSP00000362649	0.990	Histone deacetylase 1
15	9606.ENSP00000392270	0.988	Serine-threonine kinase receptor-associated protein
16	9606.ENSP00000361107	0.987	Bone morphogenetic protein receptor type-1A
17	9606.ENSP00000356426	0.986	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
18	9606.ENSP00000332973	0.982	Mothers against decapentaplegic homolog 3
19	9606.ENSP00000364683	0.981	BMP and activin membrane-bound inhibitor homolog
20	9606.ENSP00000383003	0.981	Peptidyl-prolyl cis-trans isomerase FKBP1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0044389	0.976	ubiquitin-like protein ligase binding
GO:0005102	0.944	signaling receptor binding
GO:0031625	0.944	ubiquitin protein ligase binding
GO:0098772	0.929	molecular function regulator activity
GO:0044877	0.919	protein-containing complex binding
GO:0097159	0.875	organic cyclic compound binding
GO:1901363	0.874	heterocyclic compound binding
GO:0003676	0.858	nucleic acid binding
GO:0046332	0.857	SMAD binding
GO:0003677	0.851	DNA binding
GO:0005126	0.802	cytokine receptor binding
GO:0043565	0.771	sequence-specific DNA binding
GO:0005160	0.763	transforming growth factor beta receptor binding
GO:0140678	0.762	molecular function inhibitor activity
GO:1990837	0.741	sequence-specific double-stranded DNA binding
GO:0140416	0.726	transcription regulator inhibitor activity
GO:0048185	0.664	activin binding
GO:0008013	0.649	beta-catenin binding
GO:0070411	0.597	I-SMAD binding
GO:0034713	0.556	type I transforming growth factor beta receptor binding
GO:0000976	0.527	transcription cis-regulatory region binding
GO:0140110	0.446	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031323	0.996	regulation of cellular metabolic process
GO:0048519	0.995	negative regulation of biological process
GO:0023051	0.994	regulation of signaling
GO:0010646	0.994	regulation of cell communication
GO:0048583	0.993	regulation of response to stimulus
GO:0050896	0.992	response to stimulus
GO:0080090	0.990	regulation of primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0048523	0.990	negative regulation of cellular process
GO:0009987	0.989	cellular process
GO:0009966	0.981	regulation of signal transduction
GO:0019220	0.977	regulation of phosphate metabolic process
GO:0010556	0.976	regulation of macromolecule biosynthetic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.969	regulation of RNA biosynthetic process
GO:0051239	0.968	regulation of multicellular organismal process
GO:0010468	0.967	regulation of gene expression
GO:0051246	0.961	regulation of protein metabolic process
GO:0048522	0.958	positive regulation of cellular process
GO:0009892	0.958	negative regulation of metabolic process
GO:0090287	0.957	regulation of cellular response to growth factor stimulus
GO:0010605	0.951	negative regulation of macromolecule metabolic process
GO:0042325	0.951	regulation of phosphorylation
GO:1903506	0.950	regulation of nucleic acid-templated transcription
GO:0031399	0.946	regulation of protein modification process
GO:0017015	0.939	regulation of transforming growth factor beta receptor signaling pathway
GO:0031324	0.938	negative regulation of cellular metabolic process
GO:0045936	0.933	negative regulation of phosphate metabolic process
GO:0001932	0.933	regulation of protein phosphorylation
GO:0051172	0.924	negative regulation of nitrogen compound metabolic process
GO:0006355	0.919	regulation of DNA-templated transcription
GO:0051716	0.918	cellular response to stimulus
GO:0007165	0.911	signal transduction
GO:0009719	0.879	response to endogenous stimulus
GO:0090101	0.878	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045595	0.866	regulation of cell differentiation
GO:0010604	0.846	positive regulation of macromolecule metabolic process
GO:0051248	0.806	negative regulation of protein metabolic process
GO:0008152	0.793	metabolic process
GO:0031400	0.763	negative regulation of protein modification process
GO:0070848	0.762	response to growth factor
GO:0032502	0.756	developmental process
GO:0032501	0.754	multicellular organismal process
GO:0071363	0.751	cellular response to growth factor stimulus
GO:0048856	0.739	anatomical structure development
GO:0051173	0.738	positive regulation of nitrogen compound metabolic process
GO:0071704	0.734	organic substance metabolic process
GO:0031325	0.726	positive regulation of cellular metabolic process
GO:0007275	0.715	multicellular organism development
GO:0044238	0.694	primary metabolic process
GO:0006807	0.662	nitrogen compound metabolic process
GO:0042326	0.646	negative regulation of phosphorylation
GO:0045934	0.634	negative regulation of nucleobase-containing compound metabolic process
GO:0043170	0.617	macromolecule metabolic process
GO:0051253	0.610	negative regulation of RNA metabolic process
GO:0044237	0.573	cellular metabolic process
GO:0051241	0.571	negative regulation of multicellular organismal process
GO:0048731	0.570	system development
GO:0042127	0.527	regulation of cell population proliferation
GO:0065009	0.523	regulation of molecular function
GO:0009890	0.520	negative regulation of biosynthetic process
GO:0051247	0.507	positive regulation of protein metabolic process
GO:0006950	0.492	response to stress
GO:0007166	0.491	cell surface receptor signaling pathway
GO:0048513	0.489	animal organ development
GO:1902679	0.481	negative regulation of RNA biosynthetic process
GO:0065008	0.472	regulation of biological quality
GO:0006357	0.466	regulation of transcription by RNA polymerase II
GO:0019538	0.465	protein metabolic process
GO:0045892	0.461	negative regulation of DNA-templated transcription
GO:0007167	0.457	enzyme-linked receptor protein signaling pathway
GO:0043412	0.452	macromolecule modification
GO:0042221	0.451	response to chemical
GO:0036211	0.444	protein modification process
GO:0001933	0.434	negative regulation of protein phosphorylation
GO:0030510	0.429	regulation of BMP signaling pathway
GO:0045935	0.427	positive regulation of nucleobase-containing compound metabolic process
GO:0071840	0.424	cellular component organization or biogenesis
GO:0031328	0.415	positive regulation of cellular biosynthetic process
GO:0045893	0.412	positive regulation of DNA-templated transcription
GO:0035556	0.408	intracellular signal transduction
GO:0016043	0.383	cellular component organization
GO:0051094	0.382	positive regulation of developmental process
GO:0050790	0.380	regulation of catalytic activity
GO:0090288	0.375	negative regulation of cellular response to growth factor stimulus
GO:0030514	0.371	negative regulation of BMP signaling pathway
GO:0000122	0.324	negative regulation of transcription by RNA polymerase II
GO:0044092	0.316	negative regulation of molecular function
GO:2000026	0.313	regulation of multicellular organismal development
GO:0051240	0.309	positive regulation of multicellular organismal process
GO:0051093	0.302	negative regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0012505	0.981	endomembrane system
GO:0005829	0.970	cytosol
GO:0032991	0.963	protein-containing complex
GO:0031982	0.793	vesicle
GO:0016020	0.424	membrane
GO:0031410	0.413	cytoplasmic vesicle
GO:0043232	0.326	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]