StarFunc result for job id O15111

User Input

>input (745 residues)
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15111	1.000	1.000	0.000	745	1.000	1.000	O15111.pdb.gz	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
2	AFDB:Q5ZJB4	0.858	0.843	3.109E-101	759	0.809	0.794	Q5ZJB4.pdb.gz	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
3	AFDB:Q4G3H4	0.864	0.850	1.085E-89	758	0.632	0.621	Q4G3H4.pdb.gz	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
4	AFDB:B0R199	0.737	0.709	4.285E-73	779	0.468	0.448	B0R199.pdb.gz
5	AFDB:O88351	0.780	0.768	1.451E-72	757	0.499	0.491	O88351.pdb.gz	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
6	AFDB:Q6INT1	0.764	0.767	5.009E-70	742	0.467	0.469	Q6INT1.pdb.gz	Q6INT1_XENLA IkappaB kinase OS=Xenopus laevis OX=8355 GN=ikbkb.L PE=1 SV=1
7	AFDB:Q5ZI83	0.667	0.672	2.790E-49	739	0.374	0.378	Q5ZI83.pdb.gz	Q5ZI83_CHICK Protein kinase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_29g15 PE=2 SV=1
8	AFDB:Q9VEZ5	0.670	0.665	1.134E-37	751	0.219	0.217	Q9VEZ5.pdb.gz	IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster OX=7227 GN=IKKbeta PE=1 SV=2
9	AFDB:Q14164	0.473	0.487	4.574E-32	716	0.196	0.204	Q14164.pdb.gz	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
10	AFDB:A7UNK0	0.452	0.461	7.604E-32	729	0.196	0.200	A7UNK0.pdb.gz
11	PDB:4im0A	0.437	0.514	8.351E-29	619	0.165	0.199	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
12	PDB:6o8bB	0.456	0.508	3.972E-27	657	0.177	0.201	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
13	PDB:6o8cA	0.422	0.485	3.141E-25	636	0.165	0.193	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
14	PDB:6s73A	0.305	0.788	2.349E-13	269	0.089	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
15	PDB:8bfsA	0.266	0.667	3.028E-13	274	0.094	0.255	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
16	PDB:4rgjA	0.281	0.433	6.828E-13	463	0.129	0.207	4rgjA.pdb.gz
17	PDB:5u6yA	0.293	0.456	9.745E-13	459	0.095	0.155	5u6yA.pdb.gz
18	PDB:3eqdA	0.289	0.631	1.194E-12	315	0.105	0.248	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:4c0tA	0.284	0.683	1.322E-12	291	0.095	0.244	4c0tA.pdb.gz
20	PDB:6pjxA	0.300	0.402	2.693E-12	543	0.107	0.147	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FJS7	0.0	673	692	0.463	0.499	A0A499FJS7_HUMAN IkappaB kinase OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
2	A0A8I5ZSH4	0.0	1268	685	0.820	0.892	A0A8I5ZSH4_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1
3	A0A8I6ANR6	0.0	1404	713	0.906	0.947	A0A8I6ANR6_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1
4	B5DF32	0.0	1391	719	0.897	0.929	B5DF32_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=2 SV=1
5	G3V926	0.0	1331	680	0.860	0.943	G3V926_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=4 SV=2
6	O14920	0.0	749	756	0.514	0.507	IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
7	O15111	0.0	1546	745	1.000	1.000	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
8	O88351	0.0	733	757	0.501	0.493	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
9	Q4G3H4	0.0	980	758	0.636	0.625	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
10	Q5ZJB4	0.0	1235	759	0.804	0.789	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
11	Q60680	0.0	1479	745	0.954	0.954	IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus OX=10090 GN=Chuk PE=1 SV=1
12	Q6INT1	0.0	671	742	0.466	0.468	Q6INT1_XENLA IkappaB kinase OS=Xenopus laevis OX=8355 GN=ikbkb.L PE=1 SV=1
13	Q9QY78	0.0	731	757	0.499	0.491	IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus OX=10116 GN=Ikbkb PE=1 SV=1
14	Q5ZI83	6.61e-163	490	739	0.396	0.399	Q5ZI83_CHICK Protein kinase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_29g15 PE=2 SV=1
15	Q9VEZ5	1.73e-46	179	751	0.154	0.153	IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster OX=7227 GN=IKKbeta PE=1 SV=2
16	Q0GKD6	2.54e-34	142	727	0.152	0.155	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
17	Q7KJQ4	1.10e-32	137	711	0.134	0.141	Q7KJQ4_DROME Protein kinase DIK2 OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=1
18	Q9V3Y8	1.11e-32	137	720	0.134	0.139	Q9V3Y8_DROME FI05319p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=2
19	Q86PE7	1.16e-32	137	720	0.134	0.139	Q86PE7_DROME SD10041p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=1 SV=1
20	Q14164	3.32e-32	135	716	0.136	0.141	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18397 IKBKB_SDD	3e-131	448.4	IQBAL scaffold dimerization domain
2	PF12179 IKKbetaNEMObind	1.1e-14	65.2	I-kappa-kinase-beta NEMO binding domain
3	PF06293 Kdo	6.5	17.6	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	1.1e-50	184.0	Protein kinase domain
5	PF17667 Pkinase_fungal	0.0026	28.2	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	1.5e-33	127.7	Protein tyrosine and serine/threonine kinase
7	PF18396 TBK1_ULD	19	16.6	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000226574	0.999	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000358983	0.999	Nuclear factor NF-kappa-B p100 subunit
4	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
5	9606.ENSP00000221452	0.998	Transcription factor RelB
6	9606.ENSP00000384273	0.998	Transcription factor p65
7	9606.ENSP00000162749	0.997	Tumor necrosis factor receptor superfamily member 1A
8	9606.ENSP00000247668	0.997	TNF receptor-associated factor 2
9	9606.ENSP00000312988	0.997	NF-kappa-B inhibitor beta
10	9606.ENSP00000433623	0.997	TNF receptor-associated factor 6
11	9606.ENSP00000335153	0.996	Heat shock protein HSP 90-alpha
12	9606.ENSP00000380697	0.994	Interferon regulatory factor 7
13	9606.ENSP00000401399	0.994	Myeloid differentiation primary response protein MyD88
14	9606.ENSP00000398698	0.992	Tumor necrosis factor
15	9606.ENSP00000430684	0.992	Inhibitor of nuclear factor kappa-B kinase subunit beta
16	9606.ENSP00000482657	0.992	Mitogen-activated protein kinase kinase kinase 14
17	9606.ENSP00000451828	0.991	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000454207	0.991	TNF receptor-associated factor 3
19	9606.ENSP00000358335	0.990	Mitogen-activated protein kinase kinase kinase 7
20	9606.ENSP00000261313	0.989	Phosphatidylethanolamine-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0042802	0.934	identical protein binding
GO:0005102	0.920	signaling receptor binding
GO:0046983	0.835	protein dimerization activity
GO:0042803	0.832	protein homodimerization activity
GO:0097110	0.814	scaffold protein binding
GO:0019899	0.658	enzyme binding
GO:0046982	0.539	protein heterodimerization activity
GO:0008384	0.408	IkappaB kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050794	0.997	regulation of cellular process
GO:0007154	0.996	cell communication
GO:0023052	0.995	signaling
GO:0007165	0.989	signal transduction
GO:0009605	0.960	response to external stimulus
GO:0051707	0.951	response to other organism
GO:0006950	0.949	response to stress
GO:0042221	0.938	response to chemical
GO:0048518	0.934	positive regulation of biological process
GO:0035556	0.904	intracellular signal transduction
GO:0019222	0.882	regulation of metabolic process
GO:0048856	0.876	anatomical structure development
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0048583	0.846	regulation of response to stimulus
GO:0048522	0.841	positive regulation of cellular process
GO:0010033	0.818	response to organic substance
GO:0080090	0.788	regulation of primary metabolic process
GO:0051171	0.786	regulation of nitrogen compound metabolic process
GO:0031323	0.780	regulation of cellular metabolic process
GO:0009966	0.757	regulation of signal transduction
GO:0010468	0.696	regulation of gene expression
GO:0009893	0.688	positive regulation of metabolic process
GO:0010604	0.678	positive regulation of macromolecule metabolic process
GO:0032501	0.647	multicellular organismal process
GO:0071704	0.640	organic substance metabolic process
GO:0048584	0.634	positive regulation of response to stimulus
GO:0044238	0.633	primary metabolic process
GO:0006807	0.617	nitrogen compound metabolic process
GO:0009889	0.612	regulation of biosynthetic process
GO:0010556	0.604	regulation of macromolecule biosynthetic process
GO:0031326	0.604	regulation of cellular biosynthetic process
GO:0019219	0.604	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.587	negative regulation of biological process
GO:0044237	0.587	cellular metabolic process
GO:0043170	0.584	macromolecule metabolic process
GO:0019538	0.548	protein metabolic process
GO:0036211	0.544	protein modification process
GO:0051252	0.540	regulation of RNA metabolic process
GO:0048523	0.532	negative regulation of cellular process
GO:0043122	0.495	regulation of I-kappaB kinase/NF-kappaB signaling
GO:2001141	0.476	regulation of RNA biosynthetic process
GO:0006355	0.472	regulation of DNA-templated transcription
GO:0065009	0.458	regulation of molecular function
GO:1902533	0.439	positive regulation of intracellular signal transduction
GO:0051239	0.434	regulation of multicellular organismal process
GO:0002376	0.427	immune system process
GO:0044093	0.417	positive regulation of molecular function
GO:1901700	0.407	response to oxygen-containing compound
GO:0070887	0.403	cellular response to chemical stimulus
GO:0080134	0.383	regulation of response to stress
GO:0030154	0.376	cell differentiation
GO:0051090	0.354	regulation of DNA-binding transcription factor activity
GO:0071310	0.340	cellular response to organic substance
GO:0010941	0.338	regulation of cell death
GO:0002237	0.337	response to molecule of bacterial origin
GO:0001817	0.326	regulation of cytokine production
GO:0051173	0.312	positive regulation of nitrogen compound metabolic process
GO:0051240	0.309	positive regulation of multicellular organismal process
GO:0002682	0.307	regulation of immune system process
GO:0043123	0.302	positive regulation of I-kappaB kinase/NF-kappaB signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.997	protein-containing complex
GO:0043229	0.985	intracellular organelle
GO:0043227	0.977	membrane-bounded organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:1902494	0.953	catalytic complex
GO:0070013	0.951	intracellular organelle lumen
GO:0061695	0.891	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.861	protein kinase complex
GO:0016020	0.832	membrane
GO:1902554	0.822	serine/threonine protein kinase complex
GO:0005634	0.809	nucleus
GO:0005886	0.680	plasma membrane
GO:0031981	0.604	nuclear lumen
GO:0005654	0.542	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:19073	0.408	ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein]
EC:2.7.11.10	0.408	IkappaB kinase.

[back to server]