StarFunc result for job id O15116

User Input

>input (133 residues)
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR
GLSIPRADTLDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZWB1	0.918	0.918	7.945E-24	133	0.977	0.977	D3ZWB1.pdb.gz	D3ZWB1_RAT U6 snRNA-associated Sm-like protein LSm1 OS=Rattus norvegicus OX=10116 GN=Lsm1 PE=3 SV=1
2	AFDB:Q9W2K2	0.934	0.907	2.366E-18	137	0.609	0.591	Q9W2K2.pdb.gz	Q9W2K2_DROME U6 snRNA-associated Sm-like protein LSm1 OS=Drosophila melanogaster OX=7227 GN=LSm1 PE=1 SV=1
3	AFDB:P87173	0.853	0.813	2.761E-14	140	0.436	0.414	P87173.pdb.gz	LSM1_SCHPO U6 snRNA-associated Sm-like protein LSm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm1 PE=1 SV=1
4	AFDB:P47017	0.814	0.644	2.441E-13	172	0.376	0.291	P47017.pdb.gz	LSM1_YEAST Sm-like protein LSm1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM1 PE=1 SV=1
5	AFDB:Q20229	0.695	0.737	1.003E-12	125	0.459	0.488	Q20229.pdb.gz	Q20229_CAEEL U6 snRNA-associated Sm-like protein LSm1 OS=Caenorhabditis elegans OX=6239 GN=lsm-1 PE=1 SV=1
6	AFDB:Q8LFL8	0.769	0.797	1.429E-12	128	0.421	0.438	Q8LFL8.pdb.gz	LSM1B_ARATH Sm-like protein LSM1B OS=Arabidopsis thaliana OX=3702 GN=LSM1B PE=1 SV=1
7	AFDB:Q945P8	0.788	0.818	1.918E-12	128	0.414	0.430	Q945P8.pdb.gz	LSM1A_ARATH Sm-like protein LSM1A OS=Arabidopsis thaliana OX=3702 GN=LSM1A PE=1 SV=1
8	PDB:6ppnH	0.545	0.761	2.202E-8	94	0.211	0.298	6ppnH.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
9	AFDB:O74483	0.552	0.768	1.978E-7	94	0.211	0.298	O74483.pdb.gz	LSM8_SCHPO U6 snRNA-associated Sm-like protein LSm8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm8 PE=1 SV=1
10	AFDB:E7EZ02	0.567	0.777	3.361E-7	96	0.226	0.312	E7EZ02.pdb.gz	E7EZ02_DANRE U6 snRNA-associated Sm-like protein LSm8 OS=Danio rerio OX=7955 GN=LSM8 PE=1 SV=1
11	AFDB:Q9W087	0.584	0.803	3.361E-7	95	0.188	0.263	Q9W087.pdb.gz	Q9W087_DROME U6 snRNA-associated Sm-like protein LSm8 OS=Drosophila melanogaster OX=7227 GN=l(3)neo7 PE=1 SV=1
12	PDB:4c92G	0.447	0.766	4.709E-7	75	0.188	0.333	4c92G.pdb.gz
13	PDB:3jb9E	0.450	0.600	5.298E-7	98	0.165	0.224	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:3jb9J	0.466	0.829	1.282E-6	73	0.150	0.274	3jb9J.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:3bw1A	0.476	0.705	1.721E-6	86	0.150	0.233	3bw1A.pdb.gz
16	PDB:6v4xG	0.463	0.782	2.178E-6	77	0.173	0.299	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
17	PDB:6ppqG	0.451	0.691	2.599E-6	85	0.158	0.247	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
18	PDB:4m75F	0.453	0.787	3.289E-6	75	0.180	0.320	4m75F.pdb.gz
19	PDB:6exnr	0.448	0.755	3.700E-6	75	0.165	0.293	6exnr.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
20	PDB:6n7rK	0.463	0.495	3.700E-6	124	0.233	0.250	6n7rK.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15116	9.74e-93	265	133	1.000	1.000	LSM1_HUMAN U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens OX=9606 GN=LSM1 PE=1 SV=1
2	D3ZWB1	2.54e-91	262	133	0.977	0.977	D3ZWB1_RAT U6 snRNA-associated Sm-like protein LSm1 OS=Rattus norvegicus OX=10116 GN=Lsm1 PE=3 SV=1
3	Q8VC85	4.11e-91	261	133	0.977	0.977	LSM1_MOUSE U6 snRNA-associated Sm-like protein LSm1 OS=Mus musculus OX=10090 GN=Lsm1 PE=1 SV=1
4	A0A8I6GHU0	4.55e-78	228	138	0.857	0.826	A0A8I6GHU0_RAT U6 snRNA-associated Sm-like protein LSm1 OS=Rattus norvegicus OX=10116 GN=Lsm1 PE=3 SV=1
5	Q9W2K2	6.84e-50	157	137	0.594	0.577	Q9W2K2_DROME U6 snRNA-associated Sm-like protein LSm1 OS=Drosophila melanogaster OX=7227 GN=LSm1 PE=1 SV=1
6	P87173	4.34e-31	110	140	0.429	0.407	LSM1_SCHPO U6 snRNA-associated Sm-like protein LSm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm1 PE=1 SV=1
7	Q8LFL8	9.19e-29	103	128	0.406	0.422	LSM1B_ARATH Sm-like protein LSM1B OS=Arabidopsis thaliana OX=3702 GN=LSM1B PE=1 SV=1
8	Q945P8	4.97e-28	101	128	0.406	0.422	LSM1A_ARATH Sm-like protein LSM1A OS=Arabidopsis thaliana OX=3702 GN=LSM1A PE=1 SV=1
9	Q20229	2.14e-27	100	125	0.406	0.432	Q20229_CAEEL U6 snRNA-associated Sm-like protein LSm1 OS=Caenorhabditis elegans OX=6239 GN=lsm-1 PE=1 SV=1
10	P47017	8.54e-26	97.4	172	0.346	0.267	LSM1_YEAST Sm-like protein LSm1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM1 PE=1 SV=1
11	O95777	7.38e-10	54.3	96	0.226	0.312	LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 OS=Homo sapiens OX=9606 GN=LSM8 PE=1 SV=3
12	O74483	9.73e-09	51.2	94	0.211	0.298	LSM8_SCHPO U6 snRNA-associated Sm-like protein LSm8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm8 PE=1 SV=1
13	E7EZ02	2.03e-08	50.4	96	0.203	0.281	E7EZ02_DANRE U6 snRNA-associated Sm-like protein LSm8 OS=Danio rerio OX=7955 GN=LSM8 PE=1 SV=1
14	Q8VYI0	9.90e-07	46.2	98	0.188	0.255	LSM8_ARATH Sm-like protein LSM8 OS=Arabidopsis thaliana OX=3702 GN=LSM8 PE=1 SV=1
15	Q9VXE0	1.94e-05	42.4	76	0.173	0.303	RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster OX=7227 GN=SNRPG PE=1 SV=1
16	Q9CAX7	2.83e-04	39.3	79	0.188	0.316	Q9CAX7_ARATH Small nuclear ribonucleoprotein G OS=Arabidopsis thaliana OX=3702 GN=F24K9.17 PE=1 SV=1
17	O74499	3.33e-04	39.7	113	0.203	0.239	LSM7_SCHPO U6 snRNA-associated Sm-like protein LSm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm7 PE=1 SV=1
18	O82221	4.16e-04	38.9	80	0.188	0.312	RUXG_ARATH Probable small nuclear ribonucleoprotein G OS=Arabidopsis thaliana OX=3702 GN=At2g23930 PE=3 SV=1
19	B5DEP7	4.21e-04	38.9	76	0.165	0.289	B5DEP7_RAT Small nuclear ribonucleoprotein G OS=Rattus norvegicus OX=10116 GN=LOC687679 PE=2 SV=1
20	P62308	4.21e-04	38.9	76	0.165	0.289	RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01423 LSM	4.1e-12	56.9	LSM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010603157.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010633182.1	0.999	U6 snRNA-associated Sm-like protein LSm7
2	885580.XP_010608184.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
3	885580.XP_010611275.1	0.998	Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA
4	885580.XP_010636199.1	0.998	Binds specifically to the 3'-terminal U-tract of U6 snRNA.
5	885580.XP_010604769.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
6	885580.XP_010609228.1	0.997	U6 snRNA-associated Sm-like protein LSm6
7	885580.XP_010631397.1	0.993	Protein PAT1 homolog 1
8	885580.XP_010606485.1	0.991	5'-3' exoribonuclease 1
9	885580.XP_010627615.1	0.973	Belongs to the DEAD box helicase family.
10	885580.XP_010620205.1	0.948	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	885580.XP_010612458.1	0.938	mRNA-decapping enzyme 2
12	885580.XP_010623168.1	0.936	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	885580.XP_010624963.1	0.900	Enhancer of mRNA-decapping protein 3
14	885580.XP_010610578.1	0.872	Enhancer of mRNA-decapping protein 4 isoform X1
15	885580.XP_010612902.1	0.856	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
16	885580.XP_010628698.1	0.844	mRNA-decapping enzyme 1B isoform X1
17	885580.XP_010637008.1	0.844	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA
18	885580.XP_010641349.1	0.844	mRNA-decapping enzyme 1A
19	885580.XP_010643325.1	0.840	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
20	885580.XP_010602210.1	0.824	Small nuclear ribonucleoprotein Sm D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0016070	0.987	RNA metabolic process
GO:0016071	0.981	mRNA metabolic process
GO:0048519	0.979	negative regulation of biological process
GO:0019222	0.940	regulation of metabolic process
GO:0010467	0.926	gene expression
GO:0006396	0.913	RNA processing
GO:0050794	0.856	regulation of cellular process
GO:0060255	0.799	regulation of macromolecule metabolic process
GO:0009892	0.781	negative regulation of metabolic process
GO:0006397	0.751	mRNA processing
GO:0010468	0.750	regulation of gene expression
GO:0008380	0.699	RNA splicing
GO:0010605	0.646	negative regulation of macromolecule metabolic process
GO:0006401	0.631	RNA catabolic process
GO:0000375	0.549	RNA splicing, via transesterification reactions
GO:0006402	0.522	mRNA catabolic process
GO:0048523	0.440	negative regulation of cellular process
GO:0071840	0.411	cellular component organization or biogenesis
GO:0000377	0.344	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0031323	0.319	regulation of cellular metabolic process
GO:0016043	0.305	cellular component organization
GO:0000956	0.305	nuclear-transcribed mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.997	cytosol
GO:0032991	0.988	protein-containing complex
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005634	0.985	nucleus
GO:0031981	0.961	nuclear lumen
GO:1990904	0.885	ribonucleoprotein complex
GO:0005654	0.877	nucleoplasm
GO:0035770	0.756	ribonucleoprotein granule
GO:0036464	0.752	cytoplasmic ribonucleoprotein granule
GO:0000932	0.345	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]