StarFunc result for job id O15117

User Input

>input (783 residues)
MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSP
KPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINL
PKEDSKPTFPWPPGNKPSLHSVNQDHDLKPLGPKSGPTPPTSENEQKQAFPKLTGVKGKF
MSASQDLEPKPLFPKPAFGQKPPLSTENSHEDESPMKNVSSSKGSPAPLGVRSKSGPLKP
AREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKIN
QEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGPPPPKP
NRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLP
PRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEK
KRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEII
RITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAE
QDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGFPAPPKQLDMGDEVYDDVDTSDFP
VSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSK
KWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIY
DND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15117	0.999	0.999	0.000	783	1.000	1.000	O15117.pdb.gz	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
2	AFDB:D3ZIE4	0.234	0.225	1.313E-77	830	0.752	0.710	D3ZIE4.pdb.gz	FYB1_RAT FYN-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fyb1 PE=1 SV=2
3	AFDB:Q96QH2	0.117	0.136	2.112E-11	670	0.207	0.242	Q96QH2.pdb.gz	PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3
4	AFDB:O94875	0.087	0.064	3.268E-6	1100	0.156	0.111	O94875.pdb.gz	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
5	PDB:2lqnA	0.080	0.189	2.142E-5	303	0.041	0.106	2lqnA.pdb.gz
6	PDB:3qwyA	0.076	0.337	3.648E-5	170	0.023	0.106	3qwyA.pdb.gz
7	PDB:2eyzA	0.076	0.189	6.591E-5	304	0.040	0.102	2eyzA.pdb.gz
8	AFDB:A0A494C1M0	0.077	0.061	1.137E-4	1011	0.163	0.127	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
9	PDB:1k9aB	0.072	0.126	2.283E-4	441	0.015	0.027	1k9aB.pdb.gz
10	PDB:2h8hA	0.068	0.117	5.882E-4	445	0.024	0.043	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
11	PDB:3ehqA	0.072	0.286	3.082E-3	182	0.020	0.088	3ehqA.pdb.gz
12	AFDB:A0A0U1RQE4	0.074	0.057	3.123E-3	1047	0.171	0.128	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
13	PDB:1k0xA	0.073	0.478	3.681E-3	108	0.015	0.111	1k0xA.pdb.gz
14	AFDB:Q24167	0.074	0.041	3.956E-3	1507	0.138	0.072	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
15	PDB:2dybA	0.068	0.174	5.908E-3	298	0.019	0.050	2dybA.pdb.gz
16	PDB:6x5hA	0.071	0.118	8.939E-3	467	0.014	0.024	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
17	PDB:1griA	0.071	0.252	1.435E-2	211	0.019	0.071	1griA.pdb.gz
18	AFDB:Q13387	0.088	0.085	1.736E-2	824	0.155	0.147	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
19	AFDB:A0A024R0Q5	0.066	0.062	1.954E-2	828	0.149	0.141	A0A024R0Q5.pdb.gz
20	AFDB:Q54I36	0.059	0.038	2.200E-2	1338	0.147	0.086	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZIE4	0.0	995	830	0.757	0.714	FYB1_RAT FYN-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fyb1 PE=1 SV=2
2	O15117	0.0	1565	783	1.000	1.000	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
3	O35601	0.0	922	819	0.762	0.729	FYB1_MOUSE FYN-binding protein 1 OS=Mus musculus OX=10090 GN=Fyb1 PE=1 SV=2
4	Q6BCL1	4.82e-20	97.4	675	0.066	0.077	PRAM_MOUSE PML-RARA-regulated adapter molecule 1 OS=Mus musculus OX=10090 GN=Pram1 PE=1 SV=2
5	Q96QH2	8.84e-20	96.7	670	0.056	0.066	PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3
6	Q5VWT5	1.61e-16	86.3	728	0.175	0.188	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
7	Q8IDX6	1.4	35.0	3130	0.043	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
8	Q7K734	2.6	33.9	672	0.026	0.030	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1
9	P00522	3.6	33.5	1620	0.020	0.010	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
10	E9PLL7	4.4	32.3	190	0.026	0.105	E9PLL7_HUMAN L3MBTL histone methyl-lysine binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=1
11	Q9WVE9	9.8	32.3	1713	0.045	0.020	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15513 DUF4651	38	15.6	Domain of unknown function (DUF4651)
2	PF14603 hSH3	6.9e-47	169.3	Helically-extended SH3 domain
3	PF00018 SH3_1	0.25	22.3	SH3 domain
4	PF07653 SH3_2	1.2e-08	45.9	Variant SH3 domain
5	PF08239 SH3_3	5.1e+02	12.5	Bacterial SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427114

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000338171	0.998	Src kinase-associated phosphoprotein 1
3	9606.ENSP00000346671	0.998	Tyrosine-protein kinase Fyn
4	9606.ENSP00000339186	0.980	GRB2-related adapter protein 2
5	9606.ENSP00000005587	0.975	Src kinase-associated phosphoprotein 2
6	9606.ENSP00000245932	0.964	Vasodilator-stimulated phosphoprotein
7	9606.ENSP00000011653	0.951	T-cell surface glycoprotein CD4
8	9606.ENSP00000354566	0.951	T-cell surface glycoprotein CD3 epsilon chain
9	9606.ENSP00000300692	0.950	T-cell surface glycoprotein CD3 delta chain
10	9606.ENSP00000354782	0.949	T-cell surface glycoprotein CD3 zeta chain
11	9606.ENSP00000378845	0.947	Linker for activation of T cells
12	9606.ENSP00000340944	0.944	Tyrosine-protein phosphatase non-receptor type 11
13	9606.ENSP00000431445	0.937	T-cell surface glycoprotein CD3 gamma chain
14	9606.ENSP00000378786	0.923	HLA class II histocompatibility antigen, DR alpha chain
15	9606.ENSP00000353099	0.918	HLA class II histocompatibility antigen, DRB1-15 beta chain
16	9606.ENSP00000365411	0.904	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
17	9606.ENSP00000380150	0.893	Caspase recruitment domain-containing protein 11
18	9606.ENSP00000362680	0.892	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000411355	0.837	Receptor-type tyrosine-protein phosphatase C
20	9606.ENSP00000417273	0.835	Cytoplasmic protein NCK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.997	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0007165	0.985	signal transduction
GO:0002376	0.982	immune system process
GO:0050778	0.981	positive regulation of immune response
GO:0007166	0.981	cell surface receptor signaling pathway
GO:0002253	0.949	activation of immune response
GO:0002768	0.945	immune response-regulating cell surface receptor signaling pathway
GO:0002757	0.942	immune response-activating signaling pathway
GO:0002429	0.923	immune response-activating cell surface receptor signaling pathway
GO:0050851	0.911	antigen receptor-mediated signaling pathway
GO:0050852	0.832	T cell receptor signaling pathway
GO:0006955	0.559	immune response
GO:0048522	0.479	positive regulation of cellular process
GO:0051179	0.456	localization
GO:0051668	0.396	localization within membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.996	membrane
GO:0005634	0.996	nucleus
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005886	0.992	plasma membrane
GO:0032991	0.981	protein-containing complex
GO:0005856	0.849	cytoskeleton
GO:0015629	0.709	actin cytoskeleton
GO:0043233	0.459	organelle lumen
GO:0070013	0.425	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]