StarFunc result for job id O15118

User Input

>input (1278 residues)
MTARGLALGLLLLLLCPAQVFSQSCVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQ
ELCPGFFFGNVSLCCDVRQLQTLKDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQF
LNVTATEDYVDPVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKD
ADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSC
QDCSIVCGPKPQPPPPPAPWTILGLDAMYVIMWITYMAFLLVFFGAFFAVWCYRKRYFVS
EYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLFTRWGSFCVRNPGCVIFFSLVF
ITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIY
QPYPSGADVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNTNCT
ILSVLNYFQNSHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGP
VFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLT
ISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAG
ILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGETL
DQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFV
SLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQASESCLFRFFKNSYSPLLLKDWMRPIVIA
IFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYT
SSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVD
NITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYS
SAVNILLGHGTRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTETMGINGSAYRVFP
YSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFG
VMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFS
GITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAKS
CATEERYKGTERERLLNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q2J0	0.958	0.959	0.000	1277	0.672	0.673	A0A2R8Q2J0.pdb.gz	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
2	AFDB:G3V7K5	0.961	0.961	0.000	1278	0.864	0.864	G3V7K5.pdb.gz	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
3	AFDB:O15118	1.000	1.000	0.000	1278	1.000	1.000	O15118.pdb.gz	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
4	AFDB:Q9VL24	0.926	0.920	0.000	1287	0.441	0.437	Q9VL24.pdb.gz	Q9VL24_DROME Niemann-Pick type C-1a, isoform A OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=2
5	AFDB:Q9UHC9	0.898	0.846	6.776E-104	1359	0.398	0.375	Q9UHC9.pdb.gz	NPCL1_HUMAN NPC1-like intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1L1 PE=1 SV=2
6	AFDB:Q6T3U4	0.899	0.863	1.419E-101	1333	0.390	0.374	Q6T3U4.pdb.gz	NPCL1_MOUSE NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1
7	AFDB:Q9VRC9	0.878	0.894	3.576E-97	1254	0.368	0.375	Q9VRC9.pdb.gz	NPC1B_DROME NPC intracellular cholesterol transporter 1 homolog 1b OS=Drosophila melanogaster OX=7227 GN=Npc1b PE=2 SV=2
8	AFDB:F4JTN1	0.860	0.848	1.141E-89	1297	0.365	0.359	F4JTN1.pdb.gz	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
9	AFDB:F4I9G5	0.852	0.864	1.379E-88	1260	0.365	0.370	F4I9G5.pdb.gz	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
10	PDB:6v3fA	0.732	0.757	9.380E-87	1234	0.384	0.398	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
11	AFDB:Q5BBG1	0.814	0.818	7.244E-81	1271	0.345	0.347	Q5BBG1.pdb.gz	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1
12	PDB:6dmyA	0.570	0.723	1.531E-33	992	0.178	0.229	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
13	PDB:6tbuA	0.385	0.559	3.709E-20	842	0.113	0.171	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
14	PDB:7n6bA	0.418	0.666	3.816E-17	757	0.091	0.153	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
15	PDB:7e2iD	0.400	0.540	1.816E-15	907	0.106	0.149	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
16	PDB:7wnxA	0.423	0.689	4.448E-14	734	0.092	0.161	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
17	PDB:3w9iF	0.347	0.419	8.489E-13	1033	0.106	0.131	3w9iF.pdb.gz
18	PDB:2v50D	0.324	0.403	1.069E-11	998	0.099	0.126	2v50D.pdb.gz
19	PDB:3nogA	0.314	0.385	2.454E-11	1012	0.092	0.117	3nogA.pdb.gz
20	PDB:4zivB	0.315	0.376	1.293E-10	1046	0.095	0.117	4zivB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IZV0	1813	1271	0.684	0.688	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
2	A0A2R8Q2J0	1777	1277	0.671	0.672	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
3	A0A8I6AL97	2281	1259	0.852	0.865	A0A8I6AL97_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
4	A0A8I6GB30	2286	1265	0.854	0.863	A0A8I6GB30_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
5	A0MJA4	900	1325	0.402	0.388	A0MJA4_CANLF Niemann-Pick C1-like 1 protein OS=Canis lupus familiaris OX=9615 GN=NPC1L1 PE=2 SV=1
6	B4DIP7	1597	776	0.604	0.995	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	F1QNG7	1810	1276	0.683	0.684	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
8	F4I9G5	744	1260	0.372	0.377	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
9	F4JTN1	701	1297	0.372	0.366	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
10	G3V7K5	2289	1278	0.855	0.855	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
11	O15118	2643	1278	1.000	1.000	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
12	O35604	2291	1277	0.864	0.865	NPC1_MOUSE NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2
13	Q59GR1	2641	1289	0.999	0.991	Q59GR1_HUMAN Niemann-Pick disease, type C1 variant (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
14	Q5BBG1	674	1271	0.364	0.366	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1
15	Q6T3U3	887	1331	0.391	0.376	NPCL1_RAT NPC1-like intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1l1 PE=1 SV=1
16	Q6T3U4	858	1333	0.394	0.377	NPCL1_MOUSE NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1
17	Q7TMD4	2290	1277	0.863	0.864	Q7TMD4_MOUSE Niemann Pick type C1 OS=Mus musculus OX=10090 GN=Npc1 PE=2 SV=1
18	Q7YU59	1058	1287	0.445	0.442	Q7YU59_DROME RE56428p OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
19	Q9U5W1	1058	1287	0.445	0.442	Q9U5W1_DROME NPC1 protein OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
20	Q9UHC9	842	1359	0.399	0.375	NPCL1_HUMAN NPC1-like intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1L1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00873 ACR_tran	1.7	17.9	AcrB/AcrD/AcrF family
2	PF03176 MMPL	0.012	26.2	MMPL family
3	PF16414 NPC1_N	5.7e-71	250.6	Niemann-Pick C1 N terminus
4	PF02460 Patched	5.6e-81	284.5	Patched family
5	PF12349 Sterol-sensing	2.5e-53	191.5	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451112	0.999	Epididymal secretory protein E1
2	9606.ENSP00000263650	0.990	Oxysterol-binding protein-related protein 5
3	9606.ENSP00000216044	0.989	GTP-binding protein 1
4	9606.ENSP00000226230	0.937	Sigma intracellular receptor 2
5	9606.ENSP00000370767	0.893	Pancreatic secretory granule membrane major glycoprotein GP2
6	9606.ENSP00000363868	0.838	ATP-binding cassette sub-family A member 1
7	9606.ENSP00000354476	0.800	Sterol regulatory element-binding protein 2
8	9606.ENSP00000345672	0.788	Cathepsin B
9	9606.ENSP00000340409	0.747	Sphingomyelin phosphodiesterase
10	9606.ENSP00000348069	0.725	Sterol regulatory element-binding protein 1
11	9606.ENSP00000452762	0.721	Electron transfer flavoprotein subunit alpha, mitochondrial
12	9606.ENSP00000264380	0.715	1-phosphatidylinositol 3-phosphate 5-kinase
13	9606.ENSP00000337446	0.713	StAR-related lipid transfer protein 3
14	9606.ENSP00000354995	0.704	ATP-binding cassette sub-family G member 1
15	9606.ENSP00000333298	0.691	Lysosome-associated membrane glycoprotein 1
16	9606.ENSP00000263847	0.667	Oxysterol-binding protein 1
17	9606.ENSP00000301178	0.666	Tyrosine-protein kinase receptor UFO
18	9606.ENSP00000380074	0.651	Sodium-coupled neutral amino acid transporter 9
19	9606.ENSP00000009041	0.650	STARD3 N-terminal-like protein
20	9606.ENSP00000341562	0.647	Beta-1,4 N-acetylgalactosaminyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015485	0.998	cholesterol binding
GO:0015248	0.997	sterol transporter activity
GO:0060089	0.984	molecular transducer activity
GO:0004888	0.942	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050789	0.978	regulation of biological process
GO:0050896	0.973	response to stimulus
GO:0050794	0.966	regulation of cellular process
GO:0051179	0.922	localization
GO:0006810	0.897	transport
GO:0048519	0.870	negative regulation of biological process
GO:0048523	0.847	negative regulation of cellular process
GO:0071702	0.823	organic substance transport
GO:0008152	0.816	metabolic process
GO:0033036	0.816	macromolecule localization
GO:0071704	0.729	organic substance metabolic process
GO:0042221	0.709	response to chemical
GO:0010876	0.705	lipid localization
GO:0044238	0.703	primary metabolic process
GO:0046686	0.688	response to cadmium ion
GO:0006869	0.653	lipid transport
GO:0042632	0.612	cholesterol homeostasis
GO:0015850	0.545	organic hydroxy compound transport
GO:0044237	0.519	cellular metabolic process
GO:0015918	0.484	sterol transport
GO:0030301	0.429	cholesterol transport
GO:0006807	0.305	nitrogen compound metabolic process
GO:0051641	0.303	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.997	endomembrane system
GO:0005764	0.997	lysosome
GO:0098588	0.985	bounding membrane of organelle
GO:0098852	0.980	lytic vacuole membrane
GO:0071944	0.969	cell periphery
GO:0005765	0.958	lysosomal membrane
GO:0005886	0.953	plasma membrane
GO:0005576	0.918	extracellular region
GO:0005634	0.883	nucleus
GO:0031982	0.827	vesicle
GO:0031975	0.653	envelope
GO:0031967	0.642	organelle envelope
GO:0097708	0.592	intracellular vesicle
GO:0005768	0.579	endosome
GO:0043230	0.553	extracellular organelle
GO:0065010	0.529	extracellular membrane-bounded organelle
GO:0070062	0.435	extracellular exosome
GO:0005635	0.406	nuclear envelope
GO:0043233	0.366	organelle lumen
GO:0070013	0.353	intracellular organelle lumen
GO:0005783	0.340	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.997	cholesterol(in) = cholesterol(out)

[back to server]