StarFunc result for job id O15119

User Input

>input (743 residues)
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTV
GTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFA
PLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMG
PLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTAL
PSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE
LQSIQRLVSGLEAKPDRSRSASP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15119	1.000	1.000	0.000	743	1.000	1.000	O15119.pdb.gz	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
2	AFDB:A0A1D5NXF3	0.313	0.317	1.337E-79	732	0.795	0.807	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
3	AFDB:A2RUW2	0.297	0.319	1.416E-70	689	0.690	0.745	A2RUW2.pdb.gz
4	AFDB:Q7ZTU9	0.314	0.338	8.840E-57	687	0.528	0.571	Q7ZTU9.pdb.gz	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
5	AFDB:Q13207	0.334	0.347	2.030E-56	712	0.542	0.566	Q13207.pdb.gz	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
6	AFDB:B0R122	0.334	0.359	1.237E-53	686	0.505	0.547	B0R122.pdb.gz	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
7	AFDB:Q8JIS6	0.251	0.214	3.444E-29	874	0.234	0.199	Q8JIS6.pdb.gz	TBX6_DANRE T-box transcription factor TBX6 OS=Danio rerio OX=7955 GN=tbx6 PE=2 SV=2
8	AFDB:P32927	0.091	0.080	7.219E-4	897	0.132	0.109	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
9	AFDB:G4SNP7	0.051	0.035	7.760E-3	1427	0.156	0.081	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
10	AFDB:P47029	0.089	0.070	2.007E-2	1046	0.127	0.090	P47029.pdb.gz	ALY2_YEAST Arrestin-related trafficking adapter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALY2 PE=1 SV=2
11	PDB:7b0xC	0.074	0.192	7.780E-2	211	0.026	0.090	7b0xC.pdb.gz
12	PDB:5a42A	0.085	0.043	8.256E-2	1597	0.022	0.010	5a42A.pdb.gz
13	PDB:3gc3A	0.084	0.163	1.047E-1	329	0.027	0.061	3gc3A.pdb.gz
14	PDB:7tysA	0.092	0.159	1.251E-1	361	0.028	0.058	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:4rtdA	0.092	0.064	1.495E-1	1122	0.024	0.016	4rtdA.pdb.gz
16	PDB:5hp5A	0.076	0.083	1.586E-1	669	0.028	0.031	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
17	PDB:7ea3J	0.088	0.076	2.551E-1	883	0.016	0.014	7ea3J.pdb.gz
18	PDB:7nycA	0.088	0.048	2.707E-1	1542	0.024	0.012	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4n6rB	0.104	0.326	3.235E-1	198	0.027	0.101	4n6rB.pdb.gz
20	PDB:7cztH	0.082	0.214	3.865E-1	221	0.019	0.063	7cztH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5NXF3	0.0	1035	732	0.789	0.801	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
2	B0R122	0.0	610	686	0.526	0.570	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
3	B8JKS6	0.0	882	689	0.689	0.743	B8JKS6_DANRE T-box transcription factor 3a OS=Danio rerio OX=7955 GN=tbx-b PE=4 SV=1
4	O15119	0.0	1519	743	1.000	1.000	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
5	P70324	0.0	1328	741	0.939	0.942	TBX3_MOUSE T-box transcription factor TBX3 OS=Mus musculus OX=10090 GN=Tbx3 PE=1 SV=3
6	Q13207	0.0	632	712	0.560	0.584	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
7	Q60707	0.0	613	711	0.553	0.578	TBX2_MOUSE T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3
8	Q7TST9	0.0	1356	743	0.943	0.943	TBX3_RAT T-box transcription factor TBX3 OS=Rattus norvegicus OX=10116 GN=Tbx3 PE=1 SV=1
9	Q7ZTU9	0.0	640	687	0.549	0.594	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
10	Q24432	2.87e-119	383	972	0.244	0.186	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
11	Q19691	2.97e-100	317	423	0.197	0.345	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
12	M9PBY6	1.56e-76	252	356	0.155	0.323	M9PBY6_DROME Dorsocross1, isoform B OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=4 SV=1
13	Q9U8L5	2.20e-76	253	391	0.157	0.299	Q9U8L5_DROME Dorsocross1, isoform A OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
14	O93288	4.69e-76	257	541	0.171	0.235	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
15	Q8MYX3	8.21e-76	252	391	0.156	0.297	Q8MYX3_DROME RE59988p OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
16	Q8UW76	4.97e-75	251	440	0.166	0.280	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
17	Q9IAK8	9.92e-75	252	492	0.164	0.248	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
18	P57082	9.97e-75	253	545	0.166	0.226	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
19	P70325	1.02e-74	254	552	0.168	0.226	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
20	Q9UMR3	2.55e-74	249	447	0.157	0.262	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	1.4e-75	264.8	T-box
2	PF12598 TBX	2e-14	65.4	T-box transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.905	Homeobox protein Nkx-2.5
2	9606.ENSP00000225983	0.884	Histone deacetylase 5
3	9606.ENSP00000372170	0.872	Homeobox protein MSX-1
4	9606.ENSP00000263025	0.866	Mitogen-activated protein kinase 3
5	9606.ENSP00000229307	0.850	Homeobox protein NANOG
6	9606.ENSP00000254846	0.844	Lysine-specific demethylase 6B
7	9606.ENSP00000362649	0.833	Histone deacetylase 1
8	9606.ENSP00000215832	0.821	Mitogen-activated protein kinase 1
9	9606.ENSP00000245451	0.807	Bone morphogenetic protein 4
10	9606.ENSP00000363804	0.800	Krueppel-like factor 4
11	9606.ENSP00000269216	0.797	Transcription factor GATA-6
12	9606.ENSP00000323588	0.784	Transcription factor SOX-2
13	9606.ENSP00000422488	0.780	Steroid hormone receptor ERR2
14	9606.ENSP00000253363	0.772	RNA-binding protein 39
15	9606.ENSP00000442053	0.770	Probable RNA-binding protein 19
16	9606.ENSP00000334458	0.767	Transcription factor GATA-4
17	9606.ENSP00000374240	0.756	Short stature homeobox protein 2
18	9606.ENSP00000239243	0.747	Homeobox protein MSX-2
19	9606.ENSP00000261917	0.736	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
20	9606.ENSP00000259915	0.720	POU domain, class 5, transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.945	DNA-binding transcription activator activity
GO:0001228	0.944	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001227	0.935	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0006355	0.994	regulation of DNA-templated transcription
GO:0007275	0.992	multicellular organism development
GO:0048513	0.980	animal organ development
GO:0048731	0.980	system development
GO:0009987	0.976	cellular process
GO:0009888	0.974	tissue development
GO:0048519	0.962	negative regulation of biological process
GO:0048523	0.950	negative regulation of cellular process
GO:0072359	0.945	circulatory system development
GO:0007507	0.931	heart development
GO:0000122	0.907	negative regulation of transcription by RNA polymerase II
GO:0048518	0.881	positive regulation of biological process
GO:0048522	0.874	positive regulation of cellular process
GO:0010604	0.857	positive regulation of macromolecule metabolic process
GO:0051173	0.847	positive regulation of nitrogen compound metabolic process
GO:0031325	0.847	positive regulation of cellular metabolic process
GO:0010557	0.776	positive regulation of macromolecule biosynthetic process
GO:0031328	0.776	positive regulation of cellular biosynthetic process
GO:0045935	0.776	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.771	response to stimulus
GO:0045893	0.768	positive regulation of DNA-templated transcription
GO:0009653	0.736	anatomical structure morphogenesis
GO:0045944	0.708	positive regulation of transcription by RNA polymerase II
GO:0030154	0.687	cell differentiation
GO:0051716	0.666	cellular response to stimulus
GO:0007154	0.637	cell communication
GO:0023052	0.634	signaling
GO:0008152	0.580	metabolic process
GO:0042127	0.544	regulation of cell population proliferation
GO:0035295	0.531	tube development
GO:0060429	0.522	epithelium development
GO:0009790	0.492	embryo development
GO:0050793	0.468	regulation of developmental process
GO:0008284	0.466	positive regulation of cell population proliferation
GO:0044237	0.461	cellular metabolic process
GO:0045595	0.416	regulation of cell differentiation
GO:0051239	0.409	regulation of multicellular organismal process
GO:0009887	0.387	animal organ morphogenesis
GO:0006950	0.321	response to stress
GO:0071704	0.315	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.706	cytoplasm
GO:0031981	0.526	nuclear lumen
GO:0005654	0.480	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]