StarFunc result for job id O15120

User Input

>input (278 residues)
MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK
RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGD
LLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAAD
VPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15120	1.000	1.000	2.754E-54	278	1.000	1.000	O15120.pdb.gz	PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
2	AFDB:Q8K3K7	0.937	0.937	9.141E-46	278	0.770	0.770	Q8K3K7.pdb.gz	PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus OX=10090 GN=Agpat2 PE=1 SV=1
3	AFDB:O35083	0.889	0.868	7.860E-32	285	0.471	0.460	O35083.pdb.gz	PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus OX=10090 GN=Agpat1 PE=1 SV=1
4	AFDB:Q7KTI0	0.815	0.835	2.325E-23	271	0.266	0.273	Q7KTI0.pdb.gz	Q7KTI0_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
5	AFDB:Q9US20	0.868	0.865	2.624E-22	279	0.281	0.280	Q9US20.pdb.gz	YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1851.02 PE=3 SV=1
6	AFDB:Q5AEL8	0.806	0.766	8.816E-22	293	0.284	0.270	Q5AEL8.pdb.gz	Q5AEL8_CANAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLC1 PE=3 SV=1
7	AFDB:P33333	0.780	0.718	1.117E-20	303	0.252	0.231	P33333.pdb.gz	PLSC_YEAST 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLC1 PE=1 SV=1
8	AFDB:P26647	0.754	0.849	5.652E-19	245	0.212	0.241	P26647.pdb.gz	PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsC PE=1 SV=1
9	AFDB:Q9LLY4	0.705	0.580	1.359E-16	344	0.201	0.163	Q9LLY4.pdb.gz	LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
10	AFDB:O53208	0.688	0.351	1.721E-15	580	0.219	0.105	O53208.pdb.gz	O53208_MYCTO Acyltransferase family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2556 PE=3 SV=1
11	PDB:5f2tB	0.457	0.481	3.335E-5	262	0.147	0.156	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:2f17A	0.215	0.227	1.611E-1	255	0.072	0.078	2f17A.pdb.gz	Pyrithiamine as a substrate for thiamine pyrophosphokinase
13	PDB:4gkvB	0.238	0.205	2.278E-1	336	0.090	0.074	4gkvB.pdb.gz	Structure of Escherichia coli AdhP (ethanol-inducible dehydrogenase) with bound NAD.
14	PDB:3ty3A	0.150	0.124	3.614E-1	358	0.086	0.067	3ty3A.pdb.gz	Crystal structure of homoisocitrate dehydrogenase from Schizosaccharomyces pombe.
15	PDB:4f86A	0.167	0.168	4.823E-1	275	0.050	0.051	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation
16	PDB:2gamC	0.196	0.160	5.110E-1	374	0.076	0.056	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
17	PDB:6xoiB	0.149	0.118	5.110E-1	403	0.061	0.042	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
18	PDB:3a4tA	0.213	0.224	5.413E-1	258	0.047	0.050	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
19	PDB:3dbrG	0.122	0.080	5.413E-1	508	0.076	0.041	3dbrG.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:1piwA	0.226	0.186	5.735E-1	360	0.086	0.067	1piwA.pdb.gz	Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15120	0.0	575	278	1.000	1.000	PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
2	Q8K3K7	1.22e-158	444	278	0.770	0.770	PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus OX=10090 GN=Agpat2 PE=1 SV=1
3	D4AC45	1.94e-152	428	265	0.705	0.740	D4AC45_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Rattus norvegicus OX=10116 GN=Agpat2 PE=1 SV=2
4	A0A024RCV5	1.77e-81	248	283	0.435	0.428	A0A024RCV5_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
5	Q99943	1.77e-81	248	283	0.435	0.428	PLCA_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Homo sapiens OX=9606 GN=AGPAT1 PE=1 SV=2
6	O35083	1.04e-79	244	285	0.468	0.456	PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus OX=10090 GN=Agpat1 PE=1 SV=1
7	Q9US20	7.67e-39	139	279	0.266	0.265	YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1851.02 PE=3 SV=1
8	Q7KTI0	6.73e-35	128	271	0.241	0.247	Q7KTI0_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
9	Q8T9K7	1.78e-34	127	271	0.237	0.244	Q8T9K7_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
10	Q5AEL8	7.68e-34	126	293	0.299	0.283	Q5AEL8_CANAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLC1 PE=3 SV=1
11	P33333	1.11e-33	126	303	0.277	0.254	PLSC_YEAST 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLC1 PE=1 SV=1
12	P26647	2.37e-26	105	245	0.230	0.261	PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsC PE=1 SV=1
13	Q9I7C1	2.52e-16	78.6	257	0.198	0.214	PLSC_PSEAE 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lptA PE=3 SV=1
14	Q9LLY4	9.19e-15	75.5	344	0.151	0.122	LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
15	O53208	1.34e-14	75.9	580	0.191	0.091	O53208_MYCTO Acyltransferase family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2556 PE=3 SV=1
16	Q8GXU8	1.95e-10	62.8	356	0.137	0.107	LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPAT1 PE=1 SV=1
17	Q8L7R3	4.81e-07	52.8	398	0.162	0.113	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
18	P74498	6.91e-07	51.2	225	0.140	0.173	P74498_SYNY3 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1848 PE=3 SV=1
19	O07807	1.35e-05	47.8	259	0.191	0.205	O07807_MYCTU Possible acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3816c PE=1 SV=1
20	O53516	2.77e-05	46.6	247	0.155	0.174	O53516_MYCTU 1-acylglycerol-3-phosphate O-acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2182c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	8.6e-31	117.8	Acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360761

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265276	0.983	Glycerol-3-phosphate acyltransferase 1, mitochondrial
2	9606.ENSP00000482571	0.981	Glycerol-3-phosphate acyltransferase 3
3	9606.ENSP00000380184	0.975	Glycerol-3-phosphate acyltransferase 4
4	9606.ENSP00000354032	0.973	Seipin
5	9606.ENSP00000389395	0.970	Glycerol-3-phosphate acyltransferase 2, mitochondrial
6	9606.ENSP00000314036	0.963	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
7	9606.ENSP00000302177	0.962	Lysophospholipid acyltransferase 2
8	9606.ENSP00000285518	0.951	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
9	9606.ENSP00000324944	0.947	Lysophospholipid acyltransferase 1
10	9606.ENSP00000397908	0.943	Phosphatidate phosphatase LPIN1
11	9606.ENSP00000381140	0.942	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
12	9606.ENSP00000264775	0.936	Phospholipid phosphatase 1
13	9606.ENSP00000310551	0.934	Lysocardiolipin acyltransferase 1
14	9606.ENSP00000329697	0.933	Phospholipid phosphatase 2
15	9606.ENSP00000360296	0.928	Phospholipid phosphatase 3
16	9606.ENSP00000295887	0.921	Phosphatidate cytidylyltransferase 1
17	9606.ENSP00000419879	0.921	Phosphatidate cytidylyltransferase 2
18	9606.ENSP00000352962	0.912	Lipid phosphate phosphatase-related protein type 3
19	9606.ENSP00000359204	0.912	Phospholipid phosphatase-related protein type 4
20	9606.ENSP00000381302	0.912	Phospholipid phosphatase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003841	1.000	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005488	0.456	binding
GO:0005515	0.450	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044255	0.987	cellular lipid metabolic process
GO:1901576	0.986	organic substance biosynthetic process
GO:0006796	0.984	phosphate-containing compound metabolic process
GO:0044249	0.980	cellular biosynthetic process
GO:0008610	0.967	lipid biosynthetic process
GO:0019637	0.966	organophosphate metabolic process
GO:0050789	0.955	regulation of biological process
GO:0006644	0.955	phospholipid metabolic process
GO:0048518	0.947	positive regulation of biological process
GO:0006650	0.946	glycerophospholipid metabolic process
GO:0045017	0.945	glycerolipid biosynthetic process
GO:0046473	0.942	phosphatidic acid metabolic process
GO:0046474	0.942	glycerophospholipid biosynthetic process
GO:0050794	0.926	regulation of cellular process
GO:0006654	0.898	phosphatidic acid biosynthetic process
GO:0060759	0.887	regulation of response to cytokine stimulus
GO:0023051	0.562	regulation of signaling
GO:0010646	0.562	regulation of cell communication
GO:0001959	0.490	regulation of cytokine-mediated signaling pathway
GO:0019222	0.334	regulation of metabolic process
GO:0048522	0.329	positive regulation of cellular process
GO:0060760	0.306	positive regulation of response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.998	organelle membrane
GO:0005789	0.983	endoplasmic reticulum membrane
GO:0071944	0.950	cell periphery
GO:0005886	0.922	plasma membrane
GO:0031982	0.812	vesicle
GO:0098588	0.785	bounding membrane of organelle
GO:0031410	0.586	cytoplasmic vesicle
GO:0012506	0.522	vesicle membrane
GO:0043233	0.510	organelle lumen
GO:0070013	0.504	intracellular organelle lumen
GO:0030659	0.459	cytoplasmic vesicle membrane
GO:0099503	0.407	secretory vesicle
GO:0030141	0.378	secretory granule
GO:0042581	0.334	specific granule
GO:0035579	0.322	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19709	1.000	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	1.000	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]