StarFunc result for job id O15121

User Input

>input (323 residues)
MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYI
VKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPY
SISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPK
PITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGH
ETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDF
VMDDTISPYSRMKRHQKGEMVLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3P1	0.996	0.996	7.484E-50	323	1.000	1.000	A0A024R3P1.pdb.gz
2	AFDB:O09005	0.995	0.995	1.037E-46	323	0.854	0.854	O09005.pdb.gz	DEGS1_MOUSE Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1
3	AFDB:Q5F3C1	0.995	0.995	1.105E-45	323	0.820	0.820	Q5F3C1.pdb.gz	DEGS1_CHICK Sphingolipid delta(4)-desaturase DES1 OS=Gallus gallus OX=9031 GN=DEGS1 PE=1 SV=1
4	AFDB:Q8R2F2	0.984	0.984	3.283E-40	323	0.644	0.644	Q8R2F2.pdb.gz	DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus OX=10090 GN=Degs2 PE=1 SV=1
5	AFDB:Q6QHC5	0.977	0.977	2.322E-39	323	0.635	0.635	Q6QHC5.pdb.gz	DEGS2_HUMAN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Homo sapiens OX=9606 GN=DEGS2 PE=1 SV=2
6	AFDB:Q94515	0.979	0.985	5.975E-37	321	0.610	0.614	Q94515.pdb.gz	DEGS1_DROME Sphingolipid delta(4)-desaturase DES1 OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1
7	AFDB:Q9ZPH4	0.958	0.932	5.695E-32	332	0.495	0.482	Q9ZPH4.pdb.gz	DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana OX=3702 GN=At4g04930 PE=2 SV=1
8	AFDB:O59715	0.930	0.831	3.004E-27	362	0.406	0.362	O59715.pdb.gz	DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsd1 PE=1 SV=1
9	AFDB:Q55D94	0.922	0.828	1.816E-22	361	0.328	0.294	Q55D94.pdb.gz	Q55D94_DICDI sphingolipid 4-desaturase OS=Dictyostelium discoideum OX=44689 GN=desA PE=3 SV=1
10	AFDB:Q4G2T3	0.675	0.446	4.203E-8	515	0.155	0.097	Q4G2T3.pdb.gz	DESAT_THAPS Sphingolipid 10-desaturase OS=Thalassiosira pseudonana OX=35128 GN=desA PE=1 SV=2
11	PDB:8d1iD	0.105	0.094	1.135	376	0.133	0.114	8d1iD.pdb.gz	Structures and gating mechanisms of human bestrophin anion channels.
12	PDB:7eibA	0.127	0.136	1.361	295	0.118	0.129	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
13	PDB:7oseB	0.150	0.137	1.788	377	0.068	0.058	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
14	PDB:4ybqB	0.107	0.089	1.872	462	0.099	0.069	4ybqB.pdb.gz
15	PDB:3t3zA	0.140	0.107	2.050	464	0.090	0.062	3t3zA.pdb.gz	Structural comparison of cytochromes P450 2A6, 2A13, and 2E1 with pilocarpine.
16	PDB:5x3xM	0.114	0.148	2.050	207	0.074	0.116	5x3xM.pdb.gz
17	PDB:6tejB	0.114	0.071	2.050	585	0.056	0.031	6tejB.pdb.gz	The ABC exporter IrtAB imports and reduces mycobacterial siderophores.
18	PDB:7ezmD	0.107	0.112	2.245	304	0.115	0.122	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
19	PDB:3rm5A	0.114	0.079	2.459	521	0.065	0.040	3rm5A.pdb.gz
20	PDB:4u14A	0.073	0.059	2.693	436	0.077	0.057	4u14A.pdb.gz	Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09005	0.0	573	323	0.854	0.854	DEGS1_MOUSE Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1
2	O15121	0.0	671	323	1.000	1.000	DEGS1_HUMAN Sphingolipid delta(4)-desaturase DES1 OS=Homo sapiens OX=9606 GN=DEGS1 PE=1 SV=1
3	Q5F3C1	0.0	574	323	0.820	0.820	DEGS1_CHICK Sphingolipid delta(4)-desaturase DES1 OS=Gallus gallus OX=9031 GN=DEGS1 PE=1 SV=1
4	Q6QHC5	4.62e-164	461	323	0.635	0.635	DEGS2_HUMAN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Homo sapiens OX=9606 GN=DEGS2 PE=1 SV=2
5	Q8R2F2	1.93e-159	449	323	0.644	0.644	DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus OX=10090 GN=Degs2 PE=1 SV=1
6	Q94515	1.85e-153	434	321	0.610	0.614	DEGS1_DROME Sphingolipid delta(4)-desaturase DES1 OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1
7	Q9ZPH4	4.94e-117	342	332	0.495	0.482	DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana OX=3702 GN=At4g04930 PE=2 SV=1
8	O59715	1.55e-82	256	362	0.402	0.359	DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsd1 PE=1 SV=1
9	Q55D94	1.76e-50	173	361	0.334	0.299	Q55D94_DICDI sphingolipid 4-desaturase OS=Dictyostelium discoideum OX=44689 GN=desA PE=3 SV=1
10	M9PC47	7.47e-48	158	102	0.204	0.647	M9PC47_DROME Infertile crescent, isoform B OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00487 FA_desaturase	3e-21	88.0	Fatty acid desaturase
2	PF08557 Lipid_DES	2e-17	73.7	Sphingolipid Delta4-desaturase (DES)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363397	0.974	Ceramide glucosyltransferase
2	9606.ENSP00000376453	0.973	Ceramide synthase 6
3	9606.ENSP00000271688	0.969	Ceramide synthase 2
4	9606.ENSP00000325485	0.968	Ceramide synthase 5
5	9606.ENSP00000342609	0.968	Alkaline ceramidase 2
6	9606.ENSP00000251363	0.965	Ceramide synthase 4
7	9606.ENSP00000354829	0.965	Phosphatidylcholine:ceramide cholinephosphotransferase 1
8	9606.ENSP00000385083	0.965	3-ketodihydrosphingosine reductase
9	9606.ENSP00000313681	0.964	Sphingosine kinase 1
10	9606.ENSP00000284382	0.963	Ceramide synthase 3
11	9606.ENSP00000245222	0.962	Sphingosine kinase 2
12	9606.ENSP00000378176	0.961	Phosphatidylcholine:ceramide cholinephosphotransferase 2
13	9606.ENSP00000434480	0.959	Alkaline ceramidase 3
14	9606.ENSP00000485582	0.958	annotation not available
15	9606.ENSP00000216264	0.957	Ceramide kinase
16	9606.ENSP00000371152	0.955	Acid ceramidase
17	9606.ENSP00000378897	0.950	Neutral ceramidase
18	9606.ENSP00000301452	0.948	Alkaline ceramidase 1
19	9606.ENSP00000315137	0.947	Sphingosine-1-phosphate phosphatase 2
20	9606.ENSP00000247225	0.946	Sphingosine-1-phosphate phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016859	1.000	cis-trans isomerase activity
GO:0042284	0.995	sphingolipid delta-4 desaturase activity
GO:0005488	0.901	binding
GO:0005515	0.874	protein binding
GO:0050251	0.545	retinol isomerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006665	0.996	sphingolipid metabolic process
GO:0030148	0.989	sphingolipid biosynthetic process
GO:0044281	0.514	small molecule metabolic process
GO:0043603	0.469	amide metabolic process
GO:0065007	0.418	biological regulation
GO:0006672	0.418	ceramide metabolic process
GO:0050789	0.409	regulation of biological process
GO:0034641	0.408	cellular nitrogen compound metabolic process
GO:0050794	0.403	regulation of cellular process
GO:0044271	0.337	cellular nitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0012505	0.998	endomembrane system
GO:0031090	0.970	organelle membrane
GO:0005789	0.926	endoplasmic reticulum membrane
GO:0005739	0.909	mitochondrion
GO:0071944	0.640	cell periphery
GO:0097708	0.593	intracellular vesicle
GO:0005886	0.571	plasma membrane
GO:0031410	0.549	cytoplasmic vesicle
GO:0098588	0.472	bounding membrane of organelle
GO:0070013	0.366	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.2.-.-	1.000	Cis-trans-isomerases.
RHEA:46544	0.995	an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O
EC:1.14.19.17	0.995	sphingolipid 4-desaturase.
RHEA:19141	0.545	all-trans-retinol = 11-cis-retinol

[back to server]