StarFunc result for job id O15123

User Input

>input (496 residues)
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15123	1.000	1.000	1.941E-77	496	1.000	1.000	O15123.pdb.gz	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
2	AFDB:O35462	0.589	0.589	3.493E-67	496	0.865	0.865	O35462.pdb.gz	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
3	AFDB:O08538	0.588	0.587	3.780E-54	498	0.603	0.600	O08538.pdb.gz	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
4	AFDB:B3DJK2	0.618	0.602	1.812E-51	513	0.577	0.558	B3DJK2.pdb.gz
5	AFDB:Q1LWR7	0.452	0.458	1.779E-49	489	0.524	0.532	Q1LWR7.pdb.gz
6	AFDB:Q9Y264	0.549	0.543	9.550E-47	503	0.454	0.447	Q9Y264.pdb.gz	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
7	AFDB:Q9WVH6	0.471	0.460	9.743E-43	509	0.472	0.460	Q9WVH6.pdb.gz	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
8	AFDB:Q5KQU0	0.419	0.433	5.985E-30	480	0.270	0.279	Q5KQU0.pdb.gz	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
9	AFDB:Q9R045	0.419	0.422	1.399E-29	493	0.282	0.284	Q9R045.pdb.gz	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
10	AFDB:O43827	0.418	0.596	6.100E-29	346	0.218	0.312	O43827.pdb.gz	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
11	PDB:1jc9A	0.413	0.912	4.933E-26	220	0.179	0.405	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:1m1jB	0.407	0.498	6.674E-25	402	0.230	0.284	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:3ghgB	0.400	0.491	8.532E-24	401	0.196	0.242	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:3ghgI	0.400	0.499	5.964E-22	394	0.210	0.264	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.405	0.501	1.051E-21	397	0.210	0.262	1ei3C.pdb.gz
16	PDB:4wmqA	0.226	0.351	8.573E-6	283	0.085	0.148	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.224	0.356	1.598E-5	281	0.091	0.160	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:7ua3A	0.079	0.017	1.228E-1	4443	0.034	0.004	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
19	PDB:7fdeP	0.133	0.297	1.630E-1	181	0.036	0.099	7fdeP.pdb.gz
20	PDB:7r7jB	0.073	0.067	4.035E-1	574	0.024	0.021	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08538	0.0	615	498	0.603	0.600	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
2	O15123	0.0	1035	496	1.000	1.000	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
3	O35460	0.0	613	497	0.601	0.600	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
4	O35462	0.0	912	496	0.865	0.865	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
5	O35608	0.0	899	496	0.853	0.853	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
6	Q15389	0.0	614	498	0.603	0.600	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
7	Q90Z18	0.0	553	489	0.526	0.534	Q90Z18_DANRE Angiopoietin-2 OS=Danio rerio OX=7955 GN=ang2 PE=2 SV=1
8	Q90Z19	0.0	581	513	0.558	0.540	Q90Z19_DANRE Angiopoietin-1 OS=Danio rerio OX=7955 GN=ang1 PE=2 SV=1
9	Q9WVH6	1.23e-150	441	509	0.462	0.450	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
10	Q9Y264	1.94e-148	436	503	0.452	0.445	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
11	O43827	3.50e-64	213	346	0.230	0.329	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
12	O95841	1.21e-63	216	491	0.308	0.312	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
13	Q640P2	5.70e-62	212	490	0.308	0.312	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1
14	Q5KQU0	4.38e-60	206	480	0.288	0.298	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
15	Q5RH53	5.69e-60	206	480	0.288	0.298	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1
16	Q9R045	6.34e-57	198	493	0.266	0.268	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
17	Q8MIP7	4.09e-56	195	442	0.244	0.274	Q8MIP7_PIG Fibrinogen-like protein 2 OS=Sus scrofa OX=9823 GN=FGL2 PE=4 SV=1
18	Q5KQT9	4.71e-56	196	510	0.278	0.271	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
19	B0UXH5	4.79e-56	197	519	0.278	0.266	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
20	Q9UKU9	2.32e-55	194	493	0.274	0.276	ANGL2_HUMAN Angiopoietin-related protein 2 OS=Homo sapiens OX=9606 GN=ANGPTL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18977 DUF5713	4.7e+02	12.5	Family of unknown function (DUF5713)
2	PF00147 Fibrinogen_C	2.5e-65	231.9	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369375	0.999	Angiopoietin-1 receptor
2	9606.ENSP00000431418	0.994	High affinity nerve growth factor receptor
3	9606.ENSP00000478570	0.991	Vascular endothelial growth factor A
4	9606.ENSP00000361554	0.972	Tyrosine-protein kinase receptor Tie-1
5	9606.ENSP00000263923	0.924	Vascular endothelial growth factor receptor 2
6	9606.ENSP00000263967	0.912	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
7	9606.ENSP00000229795	0.910	Mitogen-activated protein kinase 14
8	9606.ENSP00000341208	0.908	Signal transducer and activator of transcription 5A
9	9606.ENSP00000293328	0.905	Signal transducer and activator of transcription 5B
10	9606.ENSP00000346671	0.904	Tyrosine-protein kinase Fyn
11	9606.ENSP00000428056	0.904	Phosphatidylinositol 3-kinase regulatory subunit alpha
12	9606.ENSP00000331504	0.903	Tyrosine-protein kinase Fes/Fps
13	9606.ENSP00000282397	0.895	Vascular endothelial growth factor receptor 1
14	9606.ENSP00000261937	0.855	Vascular endothelial growth factor receptor 3
15	9606.ENSP00000428340	0.841	Angiopoietin-1
16	9606.ENSP00000371347	0.810	Angiopoietin-4
17	9606.ENSP00000261799	0.805	Platelet-derived growth factor receptor beta
18	9606.ENSP00000286301	0.780	Macrophage colony-stimulating factor 1 receptor
19	9606.ENSP00000288135	0.775	Mast/stem cell growth factor receptor Kit
20	9606.ENSP00000275493	0.747	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030971	0.997	receptor tyrosine kinase binding
GO:0098772	0.772	molecular function regulator activity
GO:0005126	0.684	cytokine receptor binding
GO:0042802	0.327	identical protein binding
GO:0005172	0.326	vascular endothelial growth factor receptor binding
GO:0030545	0.323	signaling receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.991	cellular process
GO:0050896	0.990	response to stimulus
GO:0048856	0.990	anatomical structure development
GO:0051239	0.988	regulation of multicellular organismal process
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.966	multicellular organism development
GO:0048731	0.964	system development
GO:0048519	0.963	negative regulation of biological process
GO:0051716	0.941	cellular response to stimulus
GO:0071704	0.921	organic substance metabolic process
GO:0048518	0.902	positive regulation of biological process
GO:0007169	0.890	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048522	0.862	positive regulation of cellular process
GO:0048523	0.860	negative regulation of cellular process
GO:0010632	0.843	regulation of epithelial cell migration
GO:0010594	0.834	regulation of endothelial cell migration
GO:0048583	0.818	regulation of response to stimulus
GO:0032101	0.801	regulation of response to external stimulus
GO:0051241	0.797	negative regulation of multicellular organismal process
GO:0050920	0.733	regulation of chemotaxis
GO:0043170	0.725	macromolecule metabolic process
GO:0030336	0.701	negative regulation of cell migration
GO:0019222	0.688	regulation of metabolic process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0043535	0.647	regulation of blood vessel endothelial cell migration
GO:0072359	0.628	circulatory system development
GO:0080090	0.579	regulation of primary metabolic process
GO:0040017	0.563	positive regulation of locomotion
GO:0030335	0.544	positive regulation of cell migration
GO:0050793	0.534	regulation of developmental process
GO:0044238	0.514	primary metabolic process
GO:0010633	0.506	negative regulation of epithelial cell migration
GO:0009966	0.478	regulation of signal transduction
GO:0048584	0.476	positive regulation of response to stimulus
GO:0042221	0.467	response to chemical
GO:0048585	0.465	negative regulation of response to stimulus
GO:0006807	0.434	nitrogen compound metabolic process
GO:0031323	0.433	regulation of cellular metabolic process
GO:0001944	0.430	vasculature development
GO:0050926	0.428	regulation of positive chemotaxis
GO:0051240	0.398	positive regulation of multicellular organismal process
GO:0001568	0.396	blood vessel development
GO:0051171	0.394	regulation of nitrogen compound metabolic process
GO:0009653	0.390	anatomical structure morphogenesis
GO:0009893	0.375	positive regulation of metabolic process
GO:0006950	0.357	response to stress
GO:0010604	0.357	positive regulation of macromolecule metabolic process
GO:1901564	0.340	organonitrogen compound metabolic process
GO:0031325	0.329	positive regulation of cellular metabolic process
GO:0065009	0.328	regulation of molecular function
GO:0022603	0.327	regulation of anatomical structure morphogenesis
GO:0042127	0.326	regulation of cell population proliferation
GO:2000026	0.322	regulation of multicellular organismal development
GO:0030154	0.321	cell differentiation
GO:0044237	0.320	cellular metabolic process
GO:0010468	0.317	regulation of gene expression
GO:0009967	0.312	positive regulation of signal transduction
GO:0030155	0.310	regulation of cell adhesion
GO:0051173	0.304	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043226	0.881	organelle
GO:0043227	0.801	membrane-bounded organelle
GO:0005622	0.615	intracellular anatomical structure
GO:0071944	0.414	cell periphery
GO:0005886	0.355	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]